Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7934
Gene name
LocationContig_98:24940..25759
Strand+
Gene length (bp)819
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 1.2E-16 94 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09350|SR1A_PHYPO Spherulin-1A OS=Physarum polycephalum PE=1 SV=1 48 256 4.0E-52
sp|P09351|SR1B_PHYPO Spherulin-1B OS=Physarum polycephalum PE=2 SV=1 50 256 1.0E-48
sp|Q7XZY1|GL32_ORYSJ Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1 77 240 4.0E-19
sp|Q942A8|GL13_ORYSJ Germin-like protein 1-3 OS=Oryza sativa subsp. japonica GN=GER8 PE=2 SV=1 77 237 5.0E-15
sp|Q6K5Q0|GL21_ORYSJ Putative germin-like protein 2-1 OS=Oryza sativa subsp. japonica GN=Os02g0491600 PE=3 SV=1 124 213 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09350|SR1A_PHYPO Spherulin-1A OS=Physarum polycephalum PE=1 SV=1 48 256 4.0E-52
sp|P09351|SR1B_PHYPO Spherulin-1B OS=Physarum polycephalum PE=2 SV=1 50 256 1.0E-48
sp|Q7XZY1|GL32_ORYSJ Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1 77 240 4.0E-19
sp|Q942A8|GL13_ORYSJ Germin-like protein 1-3 OS=Oryza sativa subsp. japonica GN=GER8 PE=2 SV=1 77 237 5.0E-15
sp|Q6K5Q0|GL21_ORYSJ Putative germin-like protein 2-1 OS=Oryza sativa subsp. japonica GN=Os02g0491600 PE=3 SV=1 124 213 1.0E-12
sp|Q6I544|GL52_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1 77 239 2.0E-12
sp|O65252|GL25_ARATH Probable germin-like protein subfamily 2 member 5 OS=Arabidopsis thaliana GN=At5g26700 PE=2 SV=2 75 219 3.0E-12
sp|Q6K5P9|GL22_ORYSJ Putative germin-like protein 2-2 OS=Oryza sativa subsp. japonica GN=Os02g0491700 PE=3 SV=1 76 216 6.0E-12
sp|Q6YZA9|GL82_ORYSJ Germin-like protein 8-2 OS=Oryza sativa subsp. japonica GN=GER3 PE=2 SV=1 123 211 8.0E-12
sp|Q2QXJ2|GL122_ORYSJ Germin-like protein 12-2 OS=Oryza sativa subsp. japonica GN=Os12g0154800 PE=2 SV=1 77 236 1.0E-11
sp|P93000|GL23_ARATH Germin-like protein subfamily 2 member 3 OS=Arabidopsis thaliana GN=GLP8 PE=2 SV=1 125 230 1.0E-11
sp|Q9M263|GL24_ARATH Germin-like protein subfamily 2 member 4 OS=Arabidopsis thaliana GN=GLP10 PE=2 SV=1 124 237 2.0E-11
sp|P94014|GL21_ARATH Germin-like protein subfamily 2 member 1 OS=Arabidopsis thaliana GN=GLP4 PE=2 SV=2 97 211 3.0E-11
sp|Q6YZA6|GL85_ORYSJ Germin-like protein 8-5 OS=Oryza sativa subsp. japonica GN=Os08g0189400 PE=2 SV=1 124 222 4.0E-11
sp|Q2QXJ4|GL121_ORYSJ Germin-like protein 12-1 OS=Oryza sativa subsp. japonica GN=Os12g0154700 PE=2 SV=1 77 211 5.0E-11
sp|Q6YZ97|GL810_ORYSJ Germin-like protein 8-10 OS=Oryza sativa subsp. japonica GN=GLP2 PE=2 SV=1 124 237 6.0E-11
sp|Q9S8P4|RHRE_PEA Rhicadhesin receptor OS=Pisum sativum GN=GER1 PE=1 SV=2 97 237 7.0E-11
sp|Q2QXJ0|GL124_ORYSJ Putative germin-like protein 12-4 OS=Oryza sativa subsp. japonica GN=Os12g0155000 PE=3 SV=2 124 211 8.0E-11
sp|Q9SPV5|NEC1_NICPL Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE=1 SV=1 124 237 9.0E-11
sp|Q94EG3|NEC1_NICLS Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NECI PE=1 SV=1 81 237 1.0E-10
sp|Q6YZA1|GL88_ORYSJ Germin-like protein 8-8 OS=Oryza sativa subsp. japonica GN=Os08g0189700 PE=2 SV=1 124 222 1.0E-10
sp|Q6K5P8|GL23_ORYSJ Putative germin-like protein 2-3 OS=Oryza sativa subsp. japonica GN=Os02g0491800 PE=3 SV=1 77 222 2.0E-10
sp|Q6YZ99|GL89_ORYSJ Germin-like protein 8-9 OS=Oryza sativa subsp. japonica GN=Os08g0189850 PE=2 SV=1 124 222 2.0E-10
sp|Q9LEA7|GL18_ARATH Germin-like protein subfamily 1 member 8 OS=Arabidopsis thaliana GN=GLP9 PE=2 SV=2 115 216 2.0E-10
sp|Q6YZZ6|GL84_ORYSJ Germin-like protein 8-4 OS=Oryza sativa subsp. japonica GN=GER1 PE=2 SV=1 124 237 4.0E-10
sp|Q6YZA4|GL86_ORYSJ Germin-like protein 8-6 OS=Oryza sativa subsp. japonica GN=Os08g0189500 PE=2 SV=1 124 222 4.0E-10
sp|Q6YZZ2|GL87_ORYSJ Germin-like protein 8-7 OS=Oryza sativa subsp. japonica GN=GER6 PE=2 SV=1 124 222 5.0E-10
sp|Q6YZZ7|GL83_ORYSJ Germin-like protein 8-3 OS=Oryza sativa subsp. japonica GN=GER2 PE=2 SV=1 124 211 7.0E-10
sp|Q652P9|GL93_ORYSJ Germin-like protein 9-3 OS=Oryza sativa subsp. japonica GN=Os09g0568700 PE=2 SV=1 103 215 7.0E-10
sp|Q9SR72|GL32_ARATH Germin-like protein subfamily 3 member 2 OS=Arabidopsis thaliana GN=At3g10080 PE=2 SV=1 77 211 8.0E-10
sp|P92995|GLT1_ARATH Germin-like protein subfamily T member 1 OS=Arabidopsis thaliana GN=GLP1 PE=2 SV=2 93 221 1.0E-09
sp|Q2QXJ1|GL123_ORYSJ Putative germin-like protein 12-3 OS=Oryza sativa subsp. japonica GN=Os12g0154900 PE=3 SV=1 77 211 2.0E-09
sp|Q6YZY5|GL811_ORYSJ Germin-like protein 8-11 OS=Oryza sativa subsp. japonica GN=Os08g0190100 PE=1 SV=1 124 222 2.0E-09
sp|Q6ZCR3|GL812_ORYSJ Germin-like protein 8-12 OS=Oryza sativa subsp. japonica GN=Os08g0231400 PE=2 SV=1 124 211 3.0E-09
sp|P92998|GL11_ARATH Germin-like protein subfamily 1 member 1 OS=Arabidopsis thaliana GN=GLP7 PE=2 SV=2 102 239 3.0E-09
sp|Q75HJ4|GL38_ORYSJ Germin-like protein 3-8 OS=Oryza sativa subsp. japonica GN=Os03g0804700 PE=2 SV=1 81 237 3.0E-09
sp|Q9M8X6|GL16_ARATH Germin-like protein subfamily 1 member 6 OS=Arabidopsis thaliana GN=At3g04200 PE=2 SV=1 127 211 5.0E-09
sp|L8BRS3|GLP1_MORAL Germin-like protein OS=Morus alba PE=1 SV=1 123 219 5.0E-09
sp|Q6YZB2|GL81_ORYSJ Putative germin-like protein 8-1 OS=Oryza sativa subsp. japonica GN=Os08g0188900 PE=3 SV=1 124 210 9.0E-09
sp|Q9LMC9|GLT2_ARATH Germin-like protein subfamily T member 2 OS=Arabidopsis thaliana GN=At1g18980 PE=2 SV=1 107 221 9.0E-09
sp|Q9FZ27|GL22_ARATH Germin-like protein subfamily 2 member 2 OS=Arabidopsis thaliana GN=At1g02335 PE=2 SV=1 124 221 1.0E-08
sp|Q6Z964|GL813_ORYSJ Germin-like protein 8-13 OS=Oryza sativa subsp. japonica GN=Os08g0459700 PE=3 SV=1 125 210 1.0E-08
sp|P45851|OXO2_HORVU Oxalate oxidase 2 OS=Hordeum vulgare PE=2 SV=1 123 211 1.0E-08
sp|Q652Q1|GL91_ORYSJ Germin-like protein 9-1 OS=Oryza sativa subsp. japonica GN=Os09g0568500 PE=2 SV=1 103 211 1.0E-08
sp|Q851K1|GL36_ORYSJ Germin-like protein 3-6 OS=Oryza sativa subsp. japonica GN=Os03g0694000 PE=2 SV=1 123 211 1.0E-08
sp|Q851K0|GL35_ORYSJ Germin-like protein 3-5 OS=Oryza sativa subsp. japonica GN=Os03g0693900 PE=2 SV=1 123 211 1.0E-08
sp|P15290|GER2_WHEAT Oxalate oxidase GF-2.8 OS=Triticum aestivum PE=1 SV=1 123 241 1.0E-08
sp|Q7XSN6|GL41_ORYSJ Germin-like protein 4-1 OS=Oryza sativa subsp. japonica GN=Os04g0617900 PE=2 SV=2 90 233 1.0E-08
sp|Q94JF3|GL12_ORYSJ Germin-like protein 1-2 OS=Oryza sativa subsp. japonica GN=Os01g0705100 PE=3 SV=1 103 202 2.0E-08
sp|Q851J9|GL34_ORYSJ Putative germin-like protein 3-4 OS=Oryza sativa subsp. japonica GN=Os03g0693800 PE=3 SV=1 123 211 2.0E-08
sp|Q851J8|GL33_ORYSJ Germin-like protein 3-3 OS=Oryza sativa subsp. japonica GN=Os03g0693700 PE=2 SV=1 123 211 2.0E-08
sp|Q9FMA8|GL111_ARATH Germin-like protein subfamily 1 member 11 OS=Arabidopsis thaliana GN=At5g38940 PE=2 SV=1 127 211 2.0E-08
sp|Q942A7|GL14_ORYSJ Germin-like protein 1-4 OS=Oryza sativa subsp. japonica GN=Os01g0952100 PE=1 SV=1 89 237 3.0E-08
sp|Q9SFF9|GL17_ARATH Germin-like protein subfamily 1 member 7 OS=Arabidopsis thaliana GN=At3g05950 PE=2 SV=1 123 221 3.0E-08
sp|O04012|AB19B_PRUPE Auxin-binding protein ABP19b OS=Prunus persica GN=ABP19B PE=3 SV=1 123 239 4.0E-08
sp|Q6ESF0|GL24_ORYSJ Germin-like protein 2-4 OS=Oryza sativa subsp. japonica GN=Os02g0532500 PE=2 SV=1 127 222 4.0E-08
sp|P45852|GLP1_MESCR Germin-like protein OS=Mesembryanthemum crystallinum PE=2 SV=1 123 211 5.0E-08
sp|P45850|OXO1_HORVU Oxalate oxidase 1 OS=Hordeum vulgare PE=1 SV=1 70 211 8.0E-08
sp|Q9FMA6|GL112_ARATH Putative germin-like protein subfamily 1 member 12 OS=Arabidopsis thaliana GN=At5g38960 PE=3 SV=1 127 216 8.0E-08
sp|Q7F731|GL11_ORYSJ Germin-like protein 1-1 OS=Oryza sativa subsp. japonica GN=GER4 PE=2 SV=1 77 203 1.0E-07
sp|Q652Q0|GL92_ORYSJ Putative germin-like protein 9-2 OS=Oryza sativa subsp. japonica GN=Os09g0568600 PE=3 SV=1 103 198 1.0E-07
sp|Q9ZRA4|AB19A_PRUPE Auxin-binding protein ABP19a OS=Prunus persica GN=ABP19A PE=3 SV=1 123 239 1.0E-07
sp|Q8H021|GL31_ORYSJ Germin-like protein 3-1 OS=Oryza sativa subsp. japonica GN=Os03g0179000 PE=3 SV=1 100 239 2.0E-07
sp|Q9FMB0|GL19_ARATH Putative germin-like protein subfamily 1 member 9 OS=Arabidopsis thaliana GN=At5g38910 PE=3 SV=1 92 211 2.0E-07
sp|Q10BU2|GL37_ORYSJ Germin-like protein 3-7 OS=Oryza sativa subsp. japonica GN=GER7 PE=2 SV=1 106 237 3.0E-07
sp|Q9FMA9|GL110_ARATH Germin-like protein subfamily 1 member 10 OS=Arabidopsis thaliana GN=At5g38930 PE=3 SV=1 127 211 4.0E-07
sp|P26759|GER3_WHEAT Oxalate oxidase GF-3.8 OS=Triticum aestivum PE=1 SV=1 123 211 4.0E-07
sp|P46271|GLP1_BRANA Germin-like protein 1 OS=Brassica napus GN=GER1 PE=2 SV=1 108 220 6.0E-07
sp|P94040|GL31_ARATH Germin-like protein subfamily 3 member 1 OS=Arabidopsis thaliana GN=GLP1 PE=1 SV=1 123 203 1.0E-06
sp|Q9FID0|GL114_ARATH Germin-like protein subfamily 1 member 14 OS=Arabidopsis thaliana GN=At5g39110 PE=3 SV=1 124 211 1.0E-06
sp|Q9FIC6|GL117_ARATH Germin-like protein subfamily 1 member 17 OS=Arabidopsis thaliana GN=At5g39150 PE=2 SV=1 124 211 1.0E-06
sp|Q9FIC9|GL115_ARATH Germin-like protein subfamily 1 member 15 OS=Arabidopsis thaliana GN=At5g39120 PE=2 SV=1 124 211 1.0E-06
sp|P45854|GLP1_SINAL Germin-like protein 1 OS=Sinapis alba GN=GLP1 PE=2 SV=1 132 220 2.0E-06
sp|Q6ZBZ2|GL814_ORYSJ Germin-like protein 8-14 OS=Oryza sativa subsp. japonica GN=GER5 PE=1 SV=1 132 203 2.0E-06
sp|P92997|GL113_ARATH Germin-like protein subfamily 1 member 13 OS=Arabidopsis thaliana GN=GLP6 PE=2 SV=2 124 211 2.0E-06
sp|Q9FL89|GL119_ARATH Germin-like protein subfamily 1 member 19 OS=Arabidopsis thaliana GN=At5g39180 PE=2 SV=1 124 211 2.0E-06
sp|Q9M8X4|GL14_ARATH Germin-like protein subfamily 1 member 4 OS=Arabidopsis thaliana GN=At3g04180 PE=3 SV=1 123 213 3.0E-06
sp|O04011|ABP20_PRUPE Auxin-binding protein ABP20 OS=Prunus persica GN=ABP20 PE=2 SV=1 132 239 3.0E-06
sp|P94072|GL33_ARATH Germin-like protein subfamily 3 member 3 OS=Arabidopsis thaliana GN=GER3 PE=1 SV=1 132 220 5.0E-06
sp|Q688L5|GL51_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0197200 PE=2 SV=1 96 221 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7934
MRFPSLSYPLLLVSVAAGAPHWRQDAARQQHNYSDIEASLPPVVPINTRSGNDELITKLMTAPTQVDRIKLLNQP
GDFLFDFNANSTTSGTPTRGRGGFTLAATSRTMPALIGNGGAMTVGFLGPCGMNTPHVHNRATELNIIVQGRLVT
NFITENNARPIENTVSRFQMALFPQGAIHQEFNPDCQDAIFVAAFNDADPGVQQIGQNFFGLRSDVVSATLGGVQ
TINGQDIESFRNMIPANVALGIDACLKRCGIKRNPKRSLEQVLAELS*
Coding >OphauG2|7934
ATGCGTTTCCCTAGCCTCTCTTATCCTCTTCTCCTTGTCAGTGTCGCCGCCGGCGCTCCCCACTGGAGACAAGAC
GCTGCGAGGCAGCAGCACAATTATAGCGACATTGAGGCCAGTCTCCCCCCCGTCGTGCCCATCAACACGCGGTCA
GGCAACGATGAGCTCATCACCAAGCTCATGACGGCGCCGACCCAAGTCGACCGCATCAAACTGCTCAATCAGCCC
GGCGACTTTCTCTTCGACTTCAACGCCAACAGCACCACCTCGGGCACTCCAACCCGAGGCCGGGGCGGCTTCACC
CTCGCCGCCACGTCGCGCACTATGCCGGCCCTGATCGGCAACGGCGGAGCCATGACGGTTGGCTTCCTCGGCCCC
TGTGGCATGAACACGCCACATGTCCACAACCGCGCAACCGAGCTCAACATTATTGTCCAGGGCCGTCTGGTCACC
AATTTCATCACCGAGAACAACGCGCGGCCCATTGAGAATACGGTATCGCGCTTCCAAATGGCCCTTTTCCCACAA
GGCGCCATTCATCAGGAATTCAACCCAGACTGCCAAGATGCAATCTTTGTAGCAGCCTTCAACGACGCGGATCCC
GGGGTTCAGCAGATTGGGCAGAATTTCTTTGGCTTGCGCTCAGATGTGGTGAGTGCGACTCTGGGCGGCGTGCAA
ACCATCAATGGCCAGGATATCGAGTCGTTTCGCAACATGATTCCCGCAAATGTGGCTCTGGGGATAGATGCATGC
TTGAAAAGATGTGGCATTAAGCGAAATCCAAAGAGGAGTCTGGAGCAAGTGCTTGCCGAGCTGTCTTGA
Transcript >OphauG2|7934
ATGCGTTTCCCTAGCCTCTCTTATCCTCTTCTCCTTGTCAGTGTCGCCGCCGGCGCTCCCCACTGGAGACAAGAC
GCTGCGAGGCAGCAGCACAATTATAGCGACATTGAGGCCAGTCTCCCCCCCGTCGTGCCCATCAACACGCGGTCA
GGCAACGATGAGCTCATCACCAAGCTCATGACGGCGCCGACCCAAGTCGACCGCATCAAACTGCTCAATCAGCCC
GGCGACTTTCTCTTCGACTTCAACGCCAACAGCACCACCTCGGGCACTCCAACCCGAGGCCGGGGCGGCTTCACC
CTCGCCGCCACGTCGCGCACTATGCCGGCCCTGATCGGCAACGGCGGAGCCATGACGGTTGGCTTCCTCGGCCCC
TGTGGCATGAACACGCCACATGTCCACAACCGCGCAACCGAGCTCAACATTATTGTCCAGGGCCGTCTGGTCACC
AATTTCATCACCGAGAACAACGCGCGGCCCATTGAGAATACGGTATCGCGCTTCCAAATGGCCCTTTTCCCACAA
GGCGCCATTCATCAGGAATTCAACCCAGACTGCCAAGATGCAATCTTTGTAGCAGCCTTCAACGACGCGGATCCC
GGGGTTCAGCAGATTGGGCAGAATTTCTTTGGCTTGCGCTCAGATGTGGTGAGTGCGACTCTGGGCGGCGTGCAA
ACCATCAATGGCCAGGATATCGAGTCGTTTCGCAACATGATTCCCGCAAATGTGGCTCTGGGGATAGATGCATGC
TTGAAAAGATGTGGCATTAAGCGAAATCCAAAGAGGAGTCTGGAGCAAGTGCTTGCCGAGCTGTCTTGA
Gene >OphauG2|7934
ATGCGTTTCCCTAGCCTCTCTTATCCTCTTCTCCTTGTCAGTGTCGCCGCCGGCGCTCCCCACTGGAGACAAGAC
GCTGCGAGGCAGCAGCACAATTATAGCGACATTGAGGCCAGTCTCCCCCCCGTCGTGCCCATCAACACGCGGTCA
GGCAACGATGAGCTCATCACCAAGCTCATGACGGCGCCGACCCAAGTCGACCGCATCAAACTGCTCAATCAGCCC
GGCGACTTTCTCTTCGACTTCAACGCCAACAGCACCACCTCGGGCACTCCAACCCGAGGCCGGGGCGGCTTCACC
CTCGCCGCCACGTCGCGCACTATGCCGGCCCTGATCGGCAACGGCGGAGCCATGACGGTTGGCTTCCTCGGCCCC
TGTGGCATGAACACGCCACATGTCCACAACCGCGCAACCGAGCTCAACATTATTGTCCAGGGCCGTCTGGTCACC
AATTTCATCACCGAGAACAACGCGCGGCCCATTGAGAATACGGTATCGCGCTTCCAAATGGCCCTTTTCCCACAA
GGCGCCATTCATCAGGAATTCAACCCAGACTGCCAAGATGCAATCTTTGTAGCAGCCTTCAACGACGCGGATCCC
GGGGTTCAGCAGATTGGGCAGAATTTCTTTGGCTTGCGCTCAGATGTGGTGAGTGCGACTCTGGGCGGCGTGCAA
ACCATCAATGGCCAGGATATCGAGTCGTTTCGCAACATGATTCCCGCAAATGTGGCTCTGGGGATAGATGCATGC
TTGAAAAGATGTGGCATTAAGCGAAATCCAAAGAGGAGTCTGGAGCAAGTGCTTGCCGAGCTGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail