Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7923
Gene name
LocationContig_979:689..2057
Strand+
Gene length (bp)1368
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03583 LIP Secretory lipase 3.2E-73 144 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AX63|LIPA_ARTBC Lipase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00790 PE=3 SV=1 33 451 2.0E-140
sp|Q9P8W0|LIP5_CANAL Lipase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP5 PE=3 SV=2 37 445 3.0E-81
sp|Q9P8W1|LIP4_CANAL Lipase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP4 PE=3 SV=1 37 451 2.0E-80
sp|Q9P8V9|LIP8_CANAL Lipase 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP8 PE=3 SV=2 37 450 3.0E-79
sp|Q9P8W5|LIP2_CANAX Lipase 2 OS=Candida albicans GN=LIP2 PE=3 SV=1 25 451 4.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AX63|LIPA_ARTBC Lipase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00790 PE=3 SV=1 33 451 2.0E-140
sp|Q9P8W0|LIP5_CANAL Lipase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP5 PE=3 SV=2 37 445 3.0E-81
sp|Q9P8W1|LIP4_CANAL Lipase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP4 PE=3 SV=1 37 451 2.0E-80
sp|Q9P8V9|LIP8_CANAL Lipase 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP8 PE=3 SV=2 37 450 3.0E-79
sp|Q9P8W5|LIP2_CANAX Lipase 2 OS=Candida albicans GN=LIP2 PE=3 SV=1 25 451 4.0E-78
sp|O94091|LIP1_CANAX Lipase 1 OS=Candida albicans GN=LIP1 PE=3 SV=2 37 451 1.0E-77
sp|Q9P4E6|LIP9_CANAL Lipase 9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP9 PE=3 SV=2 31 415 4.0E-76
sp|Q9P4E8|LIP6_CANAL Lipase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP6 PE=3 SV=1 36 427 6.0E-75
sp|Q9P4E5|LIP10_CANAL Lipase 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP10 PE=3 SV=1 28 427 3.0E-74
sp|Q9P8W2|LIP3_CANAX Lipase 3 OS=Candida albicans GN=LIP3 PE=3 SV=2 12 451 2.0E-72
sp|P9WK88|Y1592_MYCTO Probable inactive lipase MT1628 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1628 PE=3 SV=1 37 429 2.0E-63
sp|P9WK89|Y1592_MYCTU Probable inactive lipase Rv1592c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1592c PE=1 SV=1 37 429 2.0E-63
sp|Q9P4E7|LIP7_CANAL Lipase 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP7 PE=3 SV=1 37 402 2.0E-50
sp|W3VKA4|LIPA_CANAR Lipase A OS=Candida antarctica GN=PaG_04054 PE=1 SV=2 28 451 3.0E-47
[Show less]

GO

GO Term Description Terminal node
GO:0004806 triglyceride lipase activity Yes
GO:0016042 lipid catabolic process Yes
GO:0003674 molecular_function No
GO:0016298 lipase activity No
GO:0009056 catabolic process No
GO:0006629 lipid metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0052689 carboxylic ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7923
MSLASLAALVSLLLVPLVSTAPASPAAFDQIAAGVPPSQDPFYSVPDGLDKLPPGTILKHRPPPRPIAAFGLAPV
NVEGQHQILYRTSDNFGAATATVLTVLVPHNADLTKLVSYQVAEDAALVDCAPSYAFQFDHARGPGQGTIITEAE
LLLIEGALERGWVVIIPDFLGPRAAFLANQQAGHATLDGIRAAIASGSLTGIKPRPTISMWGYSGGSLATLWAAE
LQPRYAPELQIAGAAAGGIVPNITTVIHQANKSKDAGLIPAGILGLGNAYPDLNQYIDQHLRPEFRQDFLKARQQ
CLGGNIIQFAGRDIVAMFDDPNILWGPVSVNVSSQNDPGRASPRIPLFIYKSVKDEISPIAETDQLVQDYCASGS
SIEYLRDTASSHTSLPILSAAKVLSWLIDTMDGANRNRGCTTKTVFSSLLDPATLFVLPKFLFDALLDLLGKPVG
PPFVD*
Coding >OphauG2|7923
ATGTCTCTTGCCAGTCTTGCCGCCCTGGTCTCACTGCTGTTGGTTCCTCTCGTCTCGACGGCGCCGGCGTCGCCC
GCCGCCTTTGACCAAATCGCAGCTGGAGTTCCTCCCAGTCAAGACCCCTTCTACAGCGTGCCTGATGGGCTCGAC
AAGTTGCCGCCCGGCACCATCTTGAAGCACCGTCCGCCTCCCAGGCCCATTGCTGCCTTTGGCCTTGCACCCGTC
AACGTCGAGGGACAACACCAGATCCTGTACCGCACCAGCGACAACTTTGGCGCTGCCACCGCCACTGTTCTCACC
GTGCTGGTGCCGCACAATGCCGACTTGACCAAGCTTGTCTCGTACCAGGTGGCCGAGGATGCCGCTCTCGTCGAC
TGCGCCCCGTCCTATGCCTTTCAGTTTGACCATGCGCGAGGTCCTGGCCAGGGCACAATCATCACCGAAGCAGAG
CTGCTGCTCATCGAGGGTGCTCTTGAGCGCGGCTGGGTAGTTATTATCCCAGACTTCCTCGGGCCTCGAGCTGCC
TTTCTGGCCAACCAGCAAGCCGGCCATGCAACTCTCGACGGCATCCGCGCCGCCATTGCCTCGGGCTCCTTGACC
GGCATCAAGCCCAGGCCAACCATCTCCATGTGGGGATATTCCGGCGGCAGTCTGGCCACGCTGTGGGCCGCCGAG
CTGCAGCCGCGGTATGCCCCCGAGCTCCAAATAGCTGGCGCCGCGGCCGGCGGCATCGTGCCAAACATCACCACC
GTGATCCACCAGGCCAACAAGAGCAAGGACGCTGGTCTTATCCCCGCGGGCATCCTGGGCTTGGGAAACGCGTAT
CCAGACCTCAACCAGTACATTGACCAGCATCTGCGCCCCGAGTTCCGCCAGGACTTCCTCAAGGCTCGCCAGCAG
TGTCTGGGCGGCAACATCATCCAATTCGCCGGCCGCGACATTGTTGCCATGTTCGACGACCCCAACATCCTGTGG
GGCCCCGTGTCGGTCAATGTGTCGTCGCAAAACGATCCCGGCCGAGCATCGCCCCGTATTCCTCTCTTCATCTAC
AAGTCGGTCAAGGATGAAATCAGCCCCATTGCTGAGACGGATCAACTTGTCCAAGACTACTGTGCTTCCGGCTCC
TCAATCGAGTATCTGCGTGACACGGCATCTAGCCATACTTCCCTGCCAATTCTGTCCGCGGCCAAGGTGCTGTCG
TGGCTCATTGACACCATGGATGGCGCCAACCGCAACAGGGGCTGCACCACCAAGACTGTCTTTTCGTCTCTCCTT
GATCCCGCTACTCTCTTTGTCTTGCCCAAGTTCCTCTTTGATGCGTTGCTGGACCTGTTGGGAAAGCCAGTGGGC
CCTCCGTTTGTCGACTAG
Transcript >OphauG2|7923
ATGTCTCTTGCCAGTCTTGCCGCCCTGGTCTCACTGCTGTTGGTTCCTCTCGTCTCGACGGCGCCGGCGTCGCCC
GCCGCCTTTGACCAAATCGCAGCTGGAGTTCCTCCCAGTCAAGACCCCTTCTACAGCGTGCCTGATGGGCTCGAC
AAGTTGCCGCCCGGCACCATCTTGAAGCACCGTCCGCCTCCCAGGCCCATTGCTGCCTTTGGCCTTGCACCCGTC
AACGTCGAGGGACAACACCAGATCCTGTACCGCACCAGCGACAACTTTGGCGCTGCCACCGCCACTGTTCTCACC
GTGCTGGTGCCGCACAATGCCGACTTGACCAAGCTTGTCTCGTACCAGGTGGCCGAGGATGCCGCTCTCGTCGAC
TGCGCCCCGTCCTATGCCTTTCAGTTTGACCATGCGCGAGGTCCTGGCCAGGGCACAATCATCACCGAAGCAGAG
CTGCTGCTCATCGAGGGTGCTCTTGAGCGCGGCTGGGTAGTTATTATCCCAGACTTCCTCGGGCCTCGAGCTGCC
TTTCTGGCCAACCAGCAAGCCGGCCATGCAACTCTCGACGGCATCCGCGCCGCCATTGCCTCGGGCTCCTTGACC
GGCATCAAGCCCAGGCCAACCATCTCCATGTGGGGATATTCCGGCGGCAGTCTGGCCACGCTGTGGGCCGCCGAG
CTGCAGCCGCGGTATGCCCCCGAGCTCCAAATAGCTGGCGCCGCGGCCGGCGGCATCGTGCCAAACATCACCACC
GTGATCCACCAGGCCAACAAGAGCAAGGACGCTGGTCTTATCCCCGCGGGCATCCTGGGCTTGGGAAACGCGTAT
CCAGACCTCAACCAGTACATTGACCAGCATCTGCGCCCCGAGTTCCGCCAGGACTTCCTCAAGGCTCGCCAGCAG
TGTCTGGGCGGCAACATCATCCAATTCGCCGGCCGCGACATTGTTGCCATGTTCGACGACCCCAACATCCTGTGG
GGCCCCGTGTCGGTCAATGTGTCGTCGCAAAACGATCCCGGCCGAGCATCGCCCCGTATTCCTCTCTTCATCTAC
AAGTCGGTCAAGGATGAAATCAGCCCCATTGCTGAGACGGATCAACTTGTCCAAGACTACTGTGCTTCCGGCTCC
TCAATCGAGTATCTGCGTGACACGGCATCTAGCCATACTTCCCTGCCAATTCTGTCCGCGGCCAAGGTGCTGTCG
TGGCTCATTGACACCATGGATGGCGCCAACCGCAACAGGGGCTGCACCACCAAGACTGTCTTTTCGTCTCTCCTT
GATCCCGCTACTCTCTTTGTCTTGCCCAAGTTCCTCTTTGATGCGTTGCTGGACCTGTTGGGAAAGCCAGTGGGC
CCTCCGTTTGTCGACTAG
Gene >OphauG2|7923
ATGTCTCTTGCCAGTCTTGCCGCCCTGGTCTCACTGCTGTTGGTTCCTCTCGTCTCGACGGCGCCGGCGTCGCCC
GCCGCCTTTGACCAAATCGCAGCTGGAGTTCCTCCCAGTCAAGACCCCTTCTACAGCGTGCCTGATGGGCTCGAC
AAGTTGCCGCCCGGCACCATCTTGAAGCACCGTCCGCCTCCCAGGCCCATTGCTGCCTTTGGCCTTGCACCCGTC
AACGTCGAGGGACAACACCAGATCCTGTACCGCACCAGCGACAACTTTGGCGCTGCCACCGCCACTGTTCTCACC
GTGCTGGTGCCGCACAATGCCGACTTGACCAAGCTTGTCTCGTACCAGGTGGCCGAGGATGCCGCTCTCGTCGAC
TGCGCCCCGTCCTATGCCTTTCAGTTTGACCATGCGCGAGGTCCTGGCCAGGGCACAATCATCACCGAAGCAGAG
CTGCTGCTCATCGAGGGTGCTCTTGAGCGCGGCTGGGTAGTTATTATCCCAGACTTCCTCGGGCCTCGAGCTGCC
TTTCTGGCCAACCAGCAAGCCGGCCATGCAACTCTCGACGGCATCCGCGCCGCCATTGCCTCGGGCTCCTTGACC
GGCATCAAGCCCAGGCCAACCATCTCCATGTGGGGATATTCCGGCGGCAGTCTGGCCACGCTGTGGGCCGCCGAG
CTGCAGCCGCGGTATGCCCCCGAGCTCCAAATAGCTGGCGCCGCGGCCGGCGGCATCGTGCCAAACATCACCACC
GTGATCCACCAGGCCAACAAGAGCAAGGACGCTGGTCTTATCCCCGCGGGCATCCTGGGCTTGGGAAACGCGTAT
CCAGACCTCAACCAGTACATTGACCAGCATCTGCGCCCCGAGTTCCGCCAGGACTTCCTCAAGGCTCGCCAGCAG
TGTCTGGGCGGCAACATCATCCAATTCGCCGGCCGCGACATTGTTGCCATGTTCGACGACCCCAACATCCTGTGG
GGCCCCGTGTCGGTCAATGTGTCGTCGCAAAACGATCCCGGCCGAGCATCGCCCCGTATTCCTCTCTTCATCTAC
AAGTCGGTCAAGGATGAAATCAGCCCCATTGCTGAGACGGATCAACTTGTCCAAGACTACTGTGCTTCCGGCTCC
TCAATCGAGTATCTGCGTGACACGGCATCTAGCCATACTTCCCTGCCAATTCTGTCCGCGGCCAAGGTGCTGTCG
TGGCTCATTGACACCATGGATGGCGCCAACCGCAACAGGGGCTGCACCACCAAGACTGTCTTTTCGTCTCTCCTT
GATCCCGCTACTCTCTTTGTCTTGCCCAAGTTCCTCTTTGATGCGTTGCTGGACCTGTTGGGAAAGCCAGTGGGC
CCTCCGTTTGTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail