Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7917
Gene name
LocationContig_977:3288..4061
Strand-
Gene length (bp)773
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00831 Ribosomal_L29 Ribosomal L29 protein 1.7E-16 9 64

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L805|RL35_WHEAT 60S ribosomal protein L35 OS=Triticum aestivum GN=RPL35 PE=1 SV=1 1 124 8.0E-66
sp|Q6PBC1|RL35_XENTR 60S ribosomal protein L35 OS=Xenopus tropicalis GN=rpl35 PE=2 SV=3 4 124 6.0E-32
sp|Q8JHJ1|RL35_DANRE 60S ribosomal protein L35 OS=Danio rerio GN=rpl35 PE=2 SV=3 4 124 7.0E-32
sp|Q90YT4|RL35_ICTPU 60S ribosomal protein L35 OS=Ictalurus punctatus GN=rpl35 PE=2 SV=3 4 124 1.0E-31
sp|Q6UZF7|RL35_HIPCM 60S ribosomal protein L35 OS=Hippocampus comes GN=rpl35 PE=2 SV=3 4 124 7.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L805|RL35_WHEAT 60S ribosomal protein L35 OS=Triticum aestivum GN=RPL35 PE=1 SV=1 1 124 8.0E-66
sp|Q6PBC1|RL35_XENTR 60S ribosomal protein L35 OS=Xenopus tropicalis GN=rpl35 PE=2 SV=3 4 124 6.0E-32
sp|Q8JHJ1|RL35_DANRE 60S ribosomal protein L35 OS=Danio rerio GN=rpl35 PE=2 SV=3 4 124 7.0E-32
sp|Q90YT4|RL35_ICTPU 60S ribosomal protein L35 OS=Ictalurus punctatus GN=rpl35 PE=2 SV=3 4 124 1.0E-31
sp|Q6UZF7|RL35_HIPCM 60S ribosomal protein L35 OS=Hippocampus comes GN=rpl35 PE=2 SV=3 4 124 7.0E-31
sp|Q69CJ9|RL35_OPHHA 60S ribosomal protein L35 OS=Ophiophagus hannah GN=RPL35 PE=2 SV=3 4 124 2.0E-30
sp|Q29361|RL35_PIG 60S ribosomal protein L35 OS=Sus scrofa GN=RPL35 PE=1 SV=3 4 124 2.0E-30
sp|Q3MHM7|RL35_BOVIN 60S ribosomal protein L35 OS=Bos taurus GN=RPL35 PE=2 SV=3 4 124 4.0E-30
sp|Q98TF7|RL35_CHICK 60S ribosomal protein L35 OS=Gallus gallus GN=RPL35 PE=2 SV=3 4 124 5.0E-30
sp|Q9M3D2|RL353_ARATH 60S ribosomal protein L35-3 OS=Arabidopsis thaliana GN=RPL35C PE=2 SV=1 4 123 5.0E-30
sp|P17078|RL35_RAT 60S ribosomal protein L35 OS=Rattus norvegicus GN=Rpl35 PE=1 SV=3 4 124 5.0E-30
sp|Q6ZWV7|RL35_MOUSE 60S ribosomal protein L35 OS=Mus musculus GN=Rpl35 PE=1 SV=1 4 124 5.0E-30
sp|P42766|RL35_HUMAN 60S ribosomal protein L35 OS=Homo sapiens GN=RPL35 PE=1 SV=2 4 124 9.0E-30
sp|Q9LZ41|RL354_ARATH 60S ribosomal protein L35-4 OS=Arabidopsis thaliana GN=RPL35D PE=2 SV=1 4 123 1.0E-29
sp|Q9SF53|RL351_ARATH 60S ribosomal protein L35-1 OS=Arabidopsis thaliana GN=RPL35A PE=2 SV=1 4 123 6.0E-29
sp|O80626|RL352_ARATH 60S ribosomal protein L35-2 OS=Arabidopsis thaliana GN=RPL35B PE=2 SV=1 4 123 6.0E-29
sp|Q5DVH6|RL35_PLAFE 60S ribosomal protein L35 OS=Platichthys flesus GN=rpl35 PE=2 SV=3 4 124 6.0E-29
sp|O74904|RL35_SCHPO 60S ribosomal protein L35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl35 PE=1 SV=1 6 124 2.0E-28
sp|Q9M5L0|RL35_EUPES 60S ribosomal protein L35 OS=Euphorbia esula GN=RPL35 PE=2 SV=1 4 124 4.0E-28
sp|P0CX85|RL35B_YEAST 60S ribosomal protein L35-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL35B PE=1 SV=1 6 124 9.0E-27
sp|P0CX84|RL35A_YEAST 60S ribosomal protein L35-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL35A PE=1 SV=1 6 124 9.0E-27
sp|P34662|RL35_CAEEL 60S ribosomal protein L35 OS=Caenorhabditis elegans GN=rpl-35 PE=3 SV=1 4 124 3.0E-23
sp|Q54J23|RL35_DICDI 60S ribosomal protein L35 OS=Dictyostelium discoideum GN=rpl35 PE=3 SV=1 5 124 3.0E-23
sp|P0DJ51|RL35_TETTS 60S ribosomal protein L35 OS=Tetrahymena thermophila (strain SB210) GN=RPL35 PE=1 SV=1 6 124 7.0E-22
sp|P52817|RL35_BABBO 60S ribosomal protein L35 OS=Babesia bovis GN=RPL35 PE=2 SV=1 4 122 9.0E-18
sp|Q4UIF8|RL35_THEAN 60S ribosomal protein L35 OS=Theileria annulata GN=RPL35 PE=3 SV=1 3 124 7.0E-12
sp|Q2VA69|RL36_THELE 60S ribosomal protein L35 OS=Theileria lestoquardi GN=RPL35 PE=2 SV=1 5 124 2.0E-11
sp|Q4N756|RL35_THEPA 60S ribosomal protein L35 OS=Theileria parva GN=RPL35 PE=3 SV=1 29 122 6.0E-11
sp|A5UL82|RL29_METS3 50S ribosomal protein L29P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl29p PE=3 SV=1 6 67 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7917
MSTSKVKTSQLWDKNKDDLLKQLVELKTELGQLRVQKVASSGTKLNRIHDLRKSIARVLTIVKSKQRAQLRLFYK
NKKYAPLDLRPKKTRAIRRRLSPQDSARVLEKVKKRNSHFCQRKFAIKAA*
Coding >OphauG2|7917
ATGTCGACGAGCAAAGTCAAGACCTCCCAGTTATGGGACAAGAATAAGGACGACCTATTGAAGCAACTCGTTGAG
CTCAAGACGGAACTCGGCCAGCTTCGCGTCCAAAAGGTCGCGTCATCAGGCACCAAATTGAATAGAATCCATGAT
TTACGAAAATCGATTGCCCGTGTCTTGACGATTGTCAAGAGCAAGCAGCGTGCTCAACTCCGTCTTTTCTACAAG
AACAAAAAGTACGCCCCGCTGGATCTGCGTCCCAAGAAGACTCGTGCCATTCGCCGTCGATTGTCACCCCAAGAC
AGTGCCCGCGTTCTAGAAAAGGTCAAGAAACGCAACTCGCACTTTTGCCAACGAAAGTTTGCTATCAAGGCTGCC
TAA
Transcript >OphauG2|7917
ATGTCGACGAGCAAAGTCAAGACCTCCCAGTTATGGGACAAGAATAAGGACGACCTATTGAAGCAACTCGTTGAG
CTCAAGACGGAACTCGGCCAGCTTCGCGTCCAAAAGGTCGCGTCATCAGGCACCAAATTGAATAGAATCCATGAT
TTACGAAAATCGATTGCCCGTGTCTTGACGATTGTCAAGAGCAAGCAGCGTGCTCAACTCCGTCTTTTCTACAAG
AACAAAAAGTACGCCCCGCTGGATCTGCGTCCCAAGAAGACTCGTGCCATTCGCCGTCGATTGTCACCCCAAGAC
AGTGCCCGCGTTCTAGAAAAGGTCAAGAAACGCAACTCGCACTTTTGCCAACGAAAGTTTGCTATCAAGGCTGCC
TAA
Gene >OphauG2|7917
ATGGTGAGTTCCTGCAGCTTCTTGGTCAATTCTGCCTCATTGCCTCTGGTCTCGGCGAACTCTTGGCCCAGCCGC
TACCTCAAGACTGCATCTATCAAGAGTCTCTGGCTCTCCCCCTATCTGCCTCTGTGTGTGTCGAGACTTCGTGCC
CACAAAGAGCATCGATTTGTCTCTCGCGCCTTTTCTTTCTTGTCCCGCTGCCTCTTACCGCTCCATTCCAGAACC
TCTAGGCTGACTTTACTGTTTTGTCTTCAAGTCGACGAGCAAAGTCAAGACCTCCCAGTTATGGGACAAGAATAA
GGACGACCTATTGAAGCAACTCGTTGAGCTCAAGACGGAACTCGGCCAGCTTCGCGTCCAAAAGGTCGCGTCATC
AGGCACCAAATTGAATAGAATGTATAACCACCTTCCGACACCCCATCTATTAGTCGCATCCCCTAGAGAGCCGTT
GTTGATGAGTTTCATAATAGCCATGATTTACGAAAATCGATTGCCCGTGTCTTGACGATTGTCAAGAGCAAGCAG
CGTGCTCAACTCCGTCTTTTCTACAAGAACAAAAAGTACGCCCCGCTGGATCTGCGTCCCAAGAAGACTCGTGCC
ATTCGCCGTCGATTGTCACCCCAAGACAGTGCCCGCGTTCTAGAAAAGGTCAAGAAACGCAACTCGCACTTTTGC
CAACGAAAGTTTGCTATCAAGGTACAACTAAACATTCTCCACAAACTTGTTAAGGTTTCTCCGACTTTTATTGCT
GACCAGGATTGAAGGCTGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail