Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7910
Gene name
LocationContig_975:3637..4666
Strand+
Gene length (bp)1029
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 8.4E-52 27 273
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.6E-12 32 263
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.2E-09 32 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 14 303 6.0E-36
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 12 293 1.0E-29
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 12 290 4.0E-20
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 12 290 5.0E-20
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 12 290 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 14 303 6.0E-36
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 12 293 1.0E-29
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 12 290 4.0E-20
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 12 290 5.0E-20
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 12 290 3.0E-17
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 10 294 8.0E-15
sp|O34705|PLBAC_BACSU Phospholipase YtpA OS=Bacillus subtilis (strain 168) GN=ytpA PE=1 SV=1 21 270 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5455
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7910 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4253
Ophiocordyceps camponoti-floridani Ophcf2|06094
Ophiocordyceps camponoti-rufipedis Ophun1|3879
Ophiocordyceps kimflemingae Ophio5|222
Ophiocordyceps subramaniannii Hirsu2|6202

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7910
MAKVAEGTFQVDDASFYCKTWTPDSGHVKARLVFVHGFSEHINRYNDFFPRLTAQGIEVLGWDQRGWGRSVRKPA
ERGLTGPTSQVLRDVAAFVQDKLNDGSNAPLFIMGHSMGGGEILMLAADKAYSELTARVRGWIVECPLIGFPPGG
EPPRLKIMAGRLLGRLVPRQQLKHVVPPERLSRDAAIVESVRNDELCHNTGTLEGLASLLDRTALLASGQVKLGQ
QVRSLLLAHGTGDLICSHDMAVAFVRQQSVDDVTVKSYHDAFHQLHADHCKDEFTRDLAAWILERCDNEIVKPEI
VHPGALGAKL*
Coding >OphauG2|7910
ATGGCAAAGGTGGCAGAAGGCACGTTCCAAGTCGACGACGCCAGCTTCTATTGCAAGACTTGGACGCCAGATAGC
GGTCATGTCAAAGCGAGACTCGTCTTCGTACATGGCTTCAGCGAGCACATCAATCGCTACAACGACTTCTTTCCC
CGACTGACGGCCCAAGGTATCGAGGTCCTTGGCTGGGACCAGCGCGGATGGGGCCGCAGCGTGCGCAAGCCAGCG
GAGCGAGGATTGACTGGCCCGACAAGTCAGGTTTTGCGAGACGTGGCAGCCTTTGTGCAGGACAAGCTTAATGAT
GGGTCCAACGCGCCGCTCTTCATCATGGGCCACTCAATGGGCGGGGGCGAAATTCTCATGCTGGCAGCCGACAAG
GCGTACAGCGAACTCACTGCTCGAGTGCGCGGATGGATTGTCGAGTGTCCCCTGATTGGCTTCCCGCCCGGCGGA
GAGCCACCACGGCTCAAGATTATGGCTGGTCGTCTTCTGGGCCGCCTGGTGCCGCGACAGCAGCTCAAGCACGTG
GTGCCGCCGGAGCGTCTGAGCCGCGATGCTGCCATTGTCGAGTCGGTGCGCAACGATGAGCTGTGCCACAATACA
GGGACGCTCGAGGGGCTTGCCTCGTTGCTGGACCGGACAGCTCTTCTAGCATCGGGTCAGGTGAAGCTGGGTCAA
CAGGTGCGCAGTCTGCTTTTGGCCCATGGCACTGGCGACCTTATTTGTAGCCACGACATGGCTGTGGCTTTTGTT
CGCCAGCAGAGTGTCGACGATGTCACCGTCAAGTCATACCACGACGCCTTTCATCAGTTGCATGCCGACCACTGC
AAAGATGAATTTACCCGAGACCTCGCCGCCTGGATTCTTGAGCGTTGTGACAATGAGATTGTCAAGCCAGAGATT
GTCCATCCTGGTGCTCTGGGAGCCAAGCTCTAG
Transcript >OphauG2|7910
ATGGCAAAGGTGGCAGAAGGCACGTTCCAAGTCGACGACGCCAGCTTCTATTGCAAGACTTGGACGCCAGATAGC
GGTCATGTCAAAGCGAGACTCGTCTTCGTACATGGCTTCAGCGAGCACATCAATCGCTACAACGACTTCTTTCCC
CGACTGACGGCCCAAGGTATCGAGGTCCTTGGCTGGGACCAGCGCGGATGGGGCCGCAGCGTGCGCAAGCCAGCG
GAGCGAGGATTGACTGGCCCGACAAGTCAGGTTTTGCGAGACGTGGCAGCCTTTGTGCAGGACAAGCTTAATGAT
GGGTCCAACGCGCCGCTCTTCATCATGGGCCACTCAATGGGCGGGGGCGAAATTCTCATGCTGGCAGCCGACAAG
GCGTACAGCGAACTCACTGCTCGAGTGCGCGGATGGATTGTCGAGTGTCCCCTGATTGGCTTCCCGCCCGGCGGA
GAGCCACCACGGCTCAAGATTATGGCTGGTCGTCTTCTGGGCCGCCTGGTGCCGCGACAGCAGCTCAAGCACGTG
GTGCCGCCGGAGCGTCTGAGCCGCGATGCTGCCATTGTCGAGTCGGTGCGCAACGATGAGCTGTGCCACAATACA
GGGACGCTCGAGGGGCTTGCCTCGTTGCTGGACCGGACAGCTCTTCTAGCATCGGGTCAGGTGAAGCTGGGTCAA
CAGGTGCGCAGTCTGCTTTTGGCCCATGGCACTGGCGACCTTATTTGTAGCCACGACATGGCTGTGGCTTTTGTT
CGCCAGCAGAGTGTCGACGATGTCACCGTCAAGTCATACCACGACGCCTTTCATCAGTTGCATGCCGACCACTGC
AAAGATGAATTTACCCGAGACCTCGCCGCCTGGATTCTTGAGCGTTGTGACAATGAGATTGTCAAGCCAGAGATT
GTCCATCCTGGTGCTCTGGGAGCCAAGCTCTAG
Gene >OphauG2|7910
ATGGCAAAGGTGGCAGAAGGCACGTTCCAAGTCGACGACGCCAGCTTCTATTGCAAGACTTGGACGGTAAGACAA
TTGAGTGGACAAAACAAAGAGACTAGTGTAGCAGAGGGCTGACTTTATGGGTGGGGGTGGGATGATTGCCATGTC
AAAACAAAACAGCCAGATAGCGGTCATGTCAAAGCGAGACTCGTCTTCGTACATGGCTTCAGCGAGCACATCAAT
CGCTACAACGACTTCTTTCCCCGACTGACGGCCCAAGGTATCGAGGTCCTTGGCTGGGACCAGCGCGGATGGGGC
CGCAGCGTGCGCAAGCCAGCGGAGCGAGGATTGACTGGCCCGACAAGTCAGGTTTTGCGAGACGTGGCAGCCTTT
GTGCAGGACAAGCTTAATGATGGGTCCAACGCGCCGCTCTTCATCATGGGCCACTCAATGGGCGGGGGCGAAATT
CTCATGCTGGCAGCCGACAAGGCGTACAGCGAACTCACTGCTCGAGTGCGCGGATGGATTGTCGAGTGTCCCCTG
ATTGGCTTCCCGCCCGGCGGAGAGCCACCACGGCTCAAGATTATGGCTGGTCGTCTTCTGGGCCGCCTGGTGCCG
CGACAGCAGCTCAAGCACGTGGTGCCGCCGGAGCGTCTGAGCCGCGATGCTGCCATTGTCGAGTCGGTGCGCAAC
GATGAGCTGTGCCACAATACAGGGACGCTCGAGGGGCTTGCCTCGTTGCTGGACCGGACAGCTCTTCTAGCATCG
GGTCAGGTGAAGCTGGGTCAACAGGTGCGCAGTCTGCTTTTGGCCCATGGCACTGGCGACCTTATTTGTAGCCAC
GACATGGCTGTGGCTTTTGTTCGCCAGCAGAGTGTCGACGATGTCACCGTCAAGTCATACCACGACGCCTTTCAT
CAGTTGCATGCCGACCACTGCAAAGATGAATTTACCCGAGACCTCGCCGCCTGGATTCTTGAGCGTTGTGACAAT
GAGATTGTCAAGCCAGAGATTGTCCATCCTGGTGCTCTGGGAGCCAAGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail