Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|791
Gene name
LocationContig_120:28376..32438
Strand+
Gene length (bp)4062
Transcript length (bp)4062
Coding sequence length (bp)4062
Protein length (aa) 1354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 1.2E-27 920 1092

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 520 1190 2.0E-46
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 690 1155 3.0E-35
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 691 1127 5.0E-34
sp|Q54Y08|NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum GN=ngap PE=2 SV=1 789 1201 2.0E-33
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 688 1124 7.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 520 1190 2.0E-46
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 690 1155 3.0E-35
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 691 1127 5.0E-34
sp|Q54Y08|NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum GN=ngap PE=2 SV=1 789 1201 2.0E-33
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 688 1124 7.0E-33
sp|Q8C2K5|RASL3_MOUSE RAS protein activator like-3 OS=Mus musculus GN=Rasal3 PE=1 SV=1 681 1127 1.0E-32
sp|Q5A506|BUD2_CANAL GTPase activating protein BUD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD2 PE=2 SV=1 598 1179 5.0E-32
sp|Q3UHC7|DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus GN=Dab2ip PE=1 SV=1 688 1117 3.0E-31
sp|Q5VWQ8|DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens GN=DAB2IP PE=1 SV=2 688 1117 7.0E-31
sp|Q6P730|DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus GN=Dab2ip PE=1 SV=1 688 1117 9.0E-31
sp|Q8T498|GAP2_DROME Probable Ras GTPase-activating protein OS=Drosophila melanogaster GN=CG42684 PE=1 SV=3 688 1134 2.0E-30
sp|Q9UJF2|NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens GN=RASAL2 PE=1 SV=2 688 1131 6.0E-30
sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 681 1128 4.0E-29
sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 681 1128 4.0E-29
sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 681 1128 7.0E-29
sp|Q96PV0|SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens GN=SYNGAP1 PE=1 SV=4 803 1127 3.0E-24
sp|Q9QUH6|SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus GN=Syngap1 PE=1 SV=2 803 1127 3.0E-24
sp|F6SEU4|SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus GN=Syngap1 PE=1 SV=2 803 1127 3.0E-24
sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=1 SV=2 865 1160 1.0E-23
sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 912 1157 1.0E-23
sp|P48423|GAP1_DROME GTPase-activating protein OS=Drosophila melanogaster GN=RasGAP1 PE=1 SV=2 798 1157 2.0E-20
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 769 1131 1.0E-19
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 769 1131 2.0E-19
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 918 1132 3.0E-19
sp|Q28013|RASA3_BOVIN Ras GTPase-activating protein 3 OS=Bos taurus GN=RASA3 PE=2 SV=1 923 1124 6.0E-19
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 769 1127 7.0E-19
sp|Q60790|RASA3_MOUSE Ras GTPase-activating protein 3 OS=Mus musculus GN=Rasa3 PE=1 SV=2 923 1124 1.0E-18
sp|Q9QYJ2|RASA3_RAT Ras GTPase-activating protein 3 OS=Rattus norvegicus GN=Rasa3 PE=1 SV=2 923 1124 1.0E-18
sp|Q14644|RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sapiens GN=RASA3 PE=1 SV=3 923 1124 1.0E-18
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 918 1132 2.0E-16
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 918 1132 3.0E-16
sp|Q55AR6|NFAA_DICDI Neurofibromin-A OS=Dictyostelium discoideum GN=nfaA PE=3 SV=1 868 1128 3.0E-16
sp|Q63713|RASA2_RAT Ras GTPase-activating protein 2 OS=Rattus norvegicus GN=Rasa2 PE=2 SV=1 911 1133 7.0E-15
sp|P58069|RASA2_MOUSE Ras GTPase-activating protein 2 OS=Mus musculus GN=Rasa2 PE=1 SV=2 921 1133 1.0E-14
sp|Q15283|RASA2_HUMAN Ras GTPase-activating protein 2 OS=Homo sapiens GN=RASA2 PE=1 SV=3 921 1133 4.0E-14
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 928 1128 2.0E-12
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 1008 1127 5.0E-09
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 934 1127 4.0E-08
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 1001 1128 7.0E-08
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 1001 1128 8.0E-08
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 990 1108 1.0E-07
sp|P18963|IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA1 PE=1 SV=2 889 1131 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050790 regulation of catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1182
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|791 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4846
Ophiocordyceps camponoti-floridani Ophcf2|06849
Ophiocordyceps camponoti-rufipedis Ophun1|3353
Ophiocordyceps kimflemingae Ophio5|8193
Ophiocordyceps subramaniannii Hirsu2|10322

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|791
MSSSAMQEQATPSFPGRGGQKSRDRTRSRQAPFPQYQEPCPNRPRISQSLSHQHLPQLTSSSLDSAQDLKSERPS
ASTLRSAFRTGSESAGTSHTLTPDSATSRATGSSALSLGSAAVSPRLVPRDAGSSPHHMASLRIAHGPSGGRRQG
MVFGESFGRSCDNFEFSTAPTTPTSPHRQQHQSSHGRSQQRGASVTMRPRTRTLDGTMLKQRATPPPGSDKPSHN
RVGSLGSSSGAPTKLEEPQRSCYRELTGGASNTLPKRTLGPHTINVDDANYRVSSWLPTSRPSSPSLNGVVSVDS
LPVPMPTRDPETIISLMQTLNGRMHGEVEFQTDTGGDWINGYAYIDDDNCSLLWESAPENGADPFPQLIPDLRGC
RVLLGEHPKSCKACFELVFTVQHAAHVGETSILLLRPMASDEWDHWLAALLTWQQTRQAPSKSIGGGGAVAGVAV
CGSSSSSPVVPSRPHLRRQAQSAVSENGRGSNIIKVGTVKLWNKDPPMTPPEIFRRLSTEKPRRGEDTSWTRVSC
ILHEDGEFRLLMENDISALAVIQLSQLSRCAIQQLDCTVLEEEFCIAIFPMYAPSATHMSIYRPVYLALDSRVAF
EVWFVLFRAFAVPEIYRLGGADNASIEEVEELDQEGAGELFRVYKTIVVRLTEAKITGQPPLAVEPVRTSLVEKG
TPKPDPDRSIGNYWAELMLNGEVRARTTTKSDTNNPYWREECDFTDVPQSVKKLLIVIKRLEGLPPVQTPKATGK
KAPSSPPSPKFLPKEVVCGTVSIMLDEFKRDEDREEWFQILDDKAQPIGSMLVKISYAEHVALLSKEYDAFSDLL
HRFSTKLTTLISAALPGQLRRLSETFVNIFQASGTASDWLMALIDDEIDGIGSQSSFNKLRFSGRLKSAESFESS
STTATARELLVRDMTRSLAGEANLLFRGNTLLTLSLEFHMRRLGAEYLQEVLRDKIVQLDKMDVDCEVDPSRLPH
LGHSSHHQHQFSAELDQRWSWLLLQTTEIWRCISESADRLPAELRHILKFVRAVAEDRYGDFVRAPTYTAVSGFL
FLRFLCPAILSPKLFGLLRDHPRPLTQRSLTLIAKVLQKMANQSTFGKREQWMEPMNKFLAAQRFVFRDFIDKVC
EIPGSDSSLIKSVPASYSTPATMVGRLGLMAREGFPSLPYLIDQTHSFAVLVKLWTVAHPQEIMAGTDDADVELA
SFDAMCRKLQRRTDACLEKMDRGRAEAVSKASSKHVEEEHHDDDDDEDNDNEDETQPVFVLDEPYEQQQKQEQQA
PDDDKLPPPPPPPQQTRQVGQVPMSDDDDGPSSSLPRHNEEGKKSGTMRARNGKVGRTILNGIMRIGGRSESPDA
KHR*
Coding >OphauG2|791
ATGTCATCCTCGGCAATGCAAGAACAGGCCACCCCTTCTTTCCCAGGACGAGGTGGCCAGAAATCCAGAGACCGG
ACGCGAAGTCGCCAAGCTCCTTTTCCCCAGTACCAAGAACCTTGTCCGAACCGCCCTCGCATCTCTCAGAGCCTC
TCACACCAACACCTGCCCCAACTGACGTCCTCGTCGCTTGACTCTGCCCAAGACTTAAAATCTGAGCGCCCCAGT
GCTTCAACCTTGCGCTCTGCCTTTCGAACCGGCAGTGAGTCGGCTGGCACTAGCCACACTCTGACTCCCGATAGC
GCCACTAGTCGCGCTACAGGGTCAAGTGCTTTGAGCCTTGGTTCCGCTGCAGTCTCTCCCCGACTTGTCCCCCGT
GATGCTGGGTCTTCGCCCCATCACATGGCTTCATTGAGGATTGCCCATGGCCCAAGCGGCGGGAGACGCCAAGGC
ATGGTATTTGGCGAATCCTTTGGCAGGTCATGCGACAATTTCGAGTTTAGCACTGCGCCTACTACCCCTACTTCG
CCTCATCGTCAGCAGCACCAGTCTTCCCATGGCCGCAGCCAGCAAAGGGGCGCCAGTGTCACCATGAGACCCAGG
ACCCGAACCCTCGATGGTACCATGTTGAAGCAGAGAGCCACACCGCCTCCTGGCTCCGATAAGCCCTCCCATAAT
CGGGTCGGAAGCCTTGGCTCTTCCTCTGGAGCGCCAACGAAACTTGAAGAGCCACAACGATCATGCTACCGTGAG
CTGACAGGAGGCGCATCAAATACCTTGCCTAAGCGCACACTAGGCCCCCATACTATTAATGTCGACGACGCAAAC
TATCGTGTCTCCAGCTGGCTACCGACATCGCGTCCATCTTCGCCGTCCTTGAATGGTGTAGTGTCGGTCGATTCC
CTGCCAGTTCCAATGCCAACAAGGGACCCAGAGACCATCATCTCCCTAATGCAAACGCTGAATGGCAGGATGCAC
GGAGAGGTAGAATTTCAGACTGACACTGGAGGAGACTGGATCAATGGCTACGCCTACATTGACGATGACAACTGC
AGTCTCCTTTGGGAGAGTGCGCCAGAAAATGGAGCCGACCCCTTTCCTCAGCTCATTCCCGACCTCCGAGGATGT
AGAGTTTTGCTTGGAGAGCACCCCAAGTCTTGCAAGGCTTGTTTTGAACTCGTCTTCACCGTTCAGCACGCGGCG
CATGTTGGAGAGACGTCAATTTTATTGCTACGACCCATGGCTTCCGACGAATGGGATCATTGGCTCGCTGCACTC
TTAACTTGGCAACAGACTCGACAAGCGCCCAGCAAGAGCATTGGCGGTGGCGGCGCCGTTGCGGGTGTTGCTGTG
TGTGGAAGCTCTTCGAGCAGCCCTGTGGTGCCTAGCAGACCACATTTGCGGAGACAGGCACAGTCGGCCGTGTCG
GAAAATGGGCGCGGGTCCAACATCATCAAGGTTGGAACGGTCAAGCTGTGGAACAAGGATCCGCCAATGACCCCA
CCCGAAATATTTCGACGTCTCTCGACTGAAAAGCCACGCAGGGGCGAGGATACCTCTTGGACAAGAGTATCGTGC
ATCCTTCACGAGGATGGCGAGTTTAGGCTGCTCATGGAAAACGATATATCAGCGCTGGCAGTCATTCAACTGTCC
CAATTGTCACGGTGCGCCATTCAGCAACTCGACTGCACCGTGCTCGAGGAAGAATTCTGCATTGCAATCTTTCCC
ATGTATGCGCCTTCAGCCACGCACATGTCAATTTACCGTCCAGTATATCTTGCCTTGGACAGCCGAGTAGCCTTT
GAAGTATGGTTTGTGCTGTTTCGGGCCTTTGCAGTCCCCGAGATCTACAGGCTAGGTGGCGCCGACAATGCTTCC
ATTGAGGAGGTTGAAGAATTGGACCAAGAGGGGGCGGGAGAATTGTTCCGAGTATACAAGACGATTGTTGTCAGG
CTTACCGAGGCCAAGATTACGGGCCAGCCGCCATTGGCAGTGGAACCCGTAAGGACCAGTCTTGTCGAAAAGGGC
ACACCCAAGCCGGATCCTGACCGGTCGATTGGAAACTATTGGGCTGAGCTCATGCTCAATGGCGAAGTGCGAGCA
AGAACCACAACAAAATCAGACACCAATAATCCTTATTGGCGAGAGGAATGCGATTTTACAGACGTGCCTCAATCG
GTAAAAAAGTTGCTAATTGTCATCAAGCGTCTTGAAGGATTACCACCAGTTCAAACTCCCAAGGCAACGGGAAAA
AAGGCACCTTCGTCACCACCATCACCTAAATTTTTGCCCAAGGAAGTTGTTTGCGGAACTGTGAGCATCATGTTG
GATGAATTCAAACGCGACGAGGACCGCGAAGAGTGGTTTCAAATCCTGGACGACAAGGCTCAGCCGATTGGATCG
ATGCTGGTCAAGATATCATATGCTGAACACGTTGCATTGTTGAGCAAGGAATACGATGCGTTTTCCGACCTCCTT
CATAGATTTTCCACCAAGCTTACAACTCTAATATCGGCAGCCTTGCCGGGACAGCTTCGCCGGTTGTCCGAGACA
TTTGTTAATATATTTCAAGCATCTGGAACGGCTAGCGACTGGCTCATGGCACTGATTGACGACGAGATTGACGGG
ATCGGAAGCCAGTCGTCCTTCAACAAGCTTCGATTTAGTGGACGACTAAAGTCTGCGGAATCGTTCGAGTCATCA
TCTACAACTGCTACGGCGCGAGAGTTGCTGGTGCGCGACATGACACGGTCGCTGGCTGGCGAGGCCAATTTGCTC
TTTCGGGGAAACACACTGCTCACATTGTCGCTCGAGTTCCACATGCGCAGATTGGGAGCCGAGTATCTGCAAGAA
GTGCTGCGCGACAAGATTGTCCAGCTGGACAAGATGGACGTGGACTGCGAGGTGGATCCGAGCCGGCTGCCCCAT
CTTGGCCACAGTAGTCACCACCAACATCAGTTTTCTGCAGAGCTCGACCAACGCTGGAGCTGGCTCCTCCTACAG
ACGACGGAAATATGGCGGTGCATTTCCGAGTCGGCGGACCGACTGCCGGCAGAGCTGAGACATATTCTCAAATTT
GTTCGAGCTGTTGCTGAAGACCGATATGGCGATTTCGTCCGCGCACCAACCTATACCGCCGTGTCGGGCTTCTTG
TTTCTGCGTTTTCTATGTCCAGCGATTTTGTCTCCAAAGCTGTTTGGCCTGTTGCGAGACCACCCCAGGCCGCTG
ACGCAGCGCTCACTAACCTTGATTGCAAAAGTGCTGCAAAAAATGGCCAACCAGTCCACCTTTGGCAAGCGCGAG
CAGTGGATGGAGCCGATGAACAAGTTTTTAGCAGCCCAACGCTTCGTCTTTCGCGACTTTATCGACAAGGTGTGC
GAGATTCCCGGGTCTGATAGCAGCTTGATCAAGAGCGTACCGGCAAGCTACAGCACGCCTGCGACCATGGTGGGC
CGCCTGGGCTTGATGGCTCGAGAAGGCTTCCCCAGCCTGCCATATCTGATTGACCAGACACACAGCTTTGCCGTT
CTTGTCAAGCTGTGGACTGTGGCGCACCCGCAAGAAATCATGGCGGGCACCGACGACGCCGATGTGGAGCTGGCG
AGCTTTGACGCCATGTGTCGCAAACTGCAGCGGCGCACCGACGCGTGCTTGGAGAAGATGGACCGTGGCCGCGCA
GAAGCAGTGAGCAAGGCGTCTAGCAAGCATGTCGAGGAGGAGCACCACGACGACGACGACGACGAGGACAATGAC
AACGAGGACGAGACTCAGCCCGTGTTTGTGCTTGATGAGCCATATGAGCAGCAACAGAAACAGGAACAACAAGCA
CCCGACGACGACAAGTTGCCGCCGCCGCCGCCACCGCCGCAGCAAACAAGACAGGTCGGCCAAGTGCCAATGAGC
GACGACGACGACGGGCCCAGCTCAAGTCTCCCGCGGCACAATGAAGAGGGCAAGAAGAGCGGCACGATGCGCGCG
CGGAACGGAAAGGTGGGCAGGACGATTCTCAATGGCATCATGCGCATTGGCGGCCGCTCCGAGAGCCCGGATGCC
AAGCATCGTTGA
Transcript >OphauG2|791
ATGTCATCCTCGGCAATGCAAGAACAGGCCACCCCTTCTTTCCCAGGACGAGGTGGCCAGAAATCCAGAGACCGG
ACGCGAAGTCGCCAAGCTCCTTTTCCCCAGTACCAAGAACCTTGTCCGAACCGCCCTCGCATCTCTCAGAGCCTC
TCACACCAACACCTGCCCCAACTGACGTCCTCGTCGCTTGACTCTGCCCAAGACTTAAAATCTGAGCGCCCCAGT
GCTTCAACCTTGCGCTCTGCCTTTCGAACCGGCAGTGAGTCGGCTGGCACTAGCCACACTCTGACTCCCGATAGC
GCCACTAGTCGCGCTACAGGGTCAAGTGCTTTGAGCCTTGGTTCCGCTGCAGTCTCTCCCCGACTTGTCCCCCGT
GATGCTGGGTCTTCGCCCCATCACATGGCTTCATTGAGGATTGCCCATGGCCCAAGCGGCGGGAGACGCCAAGGC
ATGGTATTTGGCGAATCCTTTGGCAGGTCATGCGACAATTTCGAGTTTAGCACTGCGCCTACTACCCCTACTTCG
CCTCATCGTCAGCAGCACCAGTCTTCCCATGGCCGCAGCCAGCAAAGGGGCGCCAGTGTCACCATGAGACCCAGG
ACCCGAACCCTCGATGGTACCATGTTGAAGCAGAGAGCCACACCGCCTCCTGGCTCCGATAAGCCCTCCCATAAT
CGGGTCGGAAGCCTTGGCTCTTCCTCTGGAGCGCCAACGAAACTTGAAGAGCCACAACGATCATGCTACCGTGAG
CTGACAGGAGGCGCATCAAATACCTTGCCTAAGCGCACACTAGGCCCCCATACTATTAATGTCGACGACGCAAAC
TATCGTGTCTCCAGCTGGCTACCGACATCGCGTCCATCTTCGCCGTCCTTGAATGGTGTAGTGTCGGTCGATTCC
CTGCCAGTTCCAATGCCAACAAGGGACCCAGAGACCATCATCTCCCTAATGCAAACGCTGAATGGCAGGATGCAC
GGAGAGGTAGAATTTCAGACTGACACTGGAGGAGACTGGATCAATGGCTACGCCTACATTGACGATGACAACTGC
AGTCTCCTTTGGGAGAGTGCGCCAGAAAATGGAGCCGACCCCTTTCCTCAGCTCATTCCCGACCTCCGAGGATGT
AGAGTTTTGCTTGGAGAGCACCCCAAGTCTTGCAAGGCTTGTTTTGAACTCGTCTTCACCGTTCAGCACGCGGCG
CATGTTGGAGAGACGTCAATTTTATTGCTACGACCCATGGCTTCCGACGAATGGGATCATTGGCTCGCTGCACTC
TTAACTTGGCAACAGACTCGACAAGCGCCCAGCAAGAGCATTGGCGGTGGCGGCGCCGTTGCGGGTGTTGCTGTG
TGTGGAAGCTCTTCGAGCAGCCCTGTGGTGCCTAGCAGACCACATTTGCGGAGACAGGCACAGTCGGCCGTGTCG
GAAAATGGGCGCGGGTCCAACATCATCAAGGTTGGAACGGTCAAGCTGTGGAACAAGGATCCGCCAATGACCCCA
CCCGAAATATTTCGACGTCTCTCGACTGAAAAGCCACGCAGGGGCGAGGATACCTCTTGGACAAGAGTATCGTGC
ATCCTTCACGAGGATGGCGAGTTTAGGCTGCTCATGGAAAACGATATATCAGCGCTGGCAGTCATTCAACTGTCC
CAATTGTCACGGTGCGCCATTCAGCAACTCGACTGCACCGTGCTCGAGGAAGAATTCTGCATTGCAATCTTTCCC
ATGTATGCGCCTTCAGCCACGCACATGTCAATTTACCGTCCAGTATATCTTGCCTTGGACAGCCGAGTAGCCTTT
GAAGTATGGTTTGTGCTGTTTCGGGCCTTTGCAGTCCCCGAGATCTACAGGCTAGGTGGCGCCGACAATGCTTCC
ATTGAGGAGGTTGAAGAATTGGACCAAGAGGGGGCGGGAGAATTGTTCCGAGTATACAAGACGATTGTTGTCAGG
CTTACCGAGGCCAAGATTACGGGCCAGCCGCCATTGGCAGTGGAACCCGTAAGGACCAGTCTTGTCGAAAAGGGC
ACACCCAAGCCGGATCCTGACCGGTCGATTGGAAACTATTGGGCTGAGCTCATGCTCAATGGCGAAGTGCGAGCA
AGAACCACAACAAAATCAGACACCAATAATCCTTATTGGCGAGAGGAATGCGATTTTACAGACGTGCCTCAATCG
GTAAAAAAGTTGCTAATTGTCATCAAGCGTCTTGAAGGATTACCACCAGTTCAAACTCCCAAGGCAACGGGAAAA
AAGGCACCTTCGTCACCACCATCACCTAAATTTTTGCCCAAGGAAGTTGTTTGCGGAACTGTGAGCATCATGTTG
GATGAATTCAAACGCGACGAGGACCGCGAAGAGTGGTTTCAAATCCTGGACGACAAGGCTCAGCCGATTGGATCG
ATGCTGGTCAAGATATCATATGCTGAACACGTTGCATTGTTGAGCAAGGAATACGATGCGTTTTCCGACCTCCTT
CATAGATTTTCCACCAAGCTTACAACTCTAATATCGGCAGCCTTGCCGGGACAGCTTCGCCGGTTGTCCGAGACA
TTTGTTAATATATTTCAAGCATCTGGAACGGCTAGCGACTGGCTCATGGCACTGATTGACGACGAGATTGACGGG
ATCGGAAGCCAGTCGTCCTTCAACAAGCTTCGATTTAGTGGACGACTAAAGTCTGCGGAATCGTTCGAGTCATCA
TCTACAACTGCTACGGCGCGAGAGTTGCTGGTGCGCGACATGACACGGTCGCTGGCTGGCGAGGCCAATTTGCTC
TTTCGGGGAAACACACTGCTCACATTGTCGCTCGAGTTCCACATGCGCAGATTGGGAGCCGAGTATCTGCAAGAA
GTGCTGCGCGACAAGATTGTCCAGCTGGACAAGATGGACGTGGACTGCGAGGTGGATCCGAGCCGGCTGCCCCAT
CTTGGCCACAGTAGTCACCACCAACATCAGTTTTCTGCAGAGCTCGACCAACGCTGGAGCTGGCTCCTCCTACAG
ACGACGGAAATATGGCGGTGCATTTCCGAGTCGGCGGACCGACTGCCGGCAGAGCTGAGACATATTCTCAAATTT
GTTCGAGCTGTTGCTGAAGACCGATATGGCGATTTCGTCCGCGCACCAACCTATACCGCCGTGTCGGGCTTCTTG
TTTCTGCGTTTTCTATGTCCAGCGATTTTGTCTCCAAAGCTGTTTGGCCTGTTGCGAGACCACCCCAGGCCGCTG
ACGCAGCGCTCACTAACCTTGATTGCAAAAGTGCTGCAAAAAATGGCCAACCAGTCCACCTTTGGCAAGCGCGAG
CAGTGGATGGAGCCGATGAACAAGTTTTTAGCAGCCCAACGCTTCGTCTTTCGCGACTTTATCGACAAGGTGTGC
GAGATTCCCGGGTCTGATAGCAGCTTGATCAAGAGCGTACCGGCAAGCTACAGCACGCCTGCGACCATGGTGGGC
CGCCTGGGCTTGATGGCTCGAGAAGGCTTCCCCAGCCTGCCATATCTGATTGACCAGACACACAGCTTTGCCGTT
CTTGTCAAGCTGTGGACTGTGGCGCACCCGCAAGAAATCATGGCGGGCACCGACGACGCCGATGTGGAGCTGGCG
AGCTTTGACGCCATGTGTCGCAAACTGCAGCGGCGCACCGACGCGTGCTTGGAGAAGATGGACCGTGGCCGCGCA
GAAGCAGTGAGCAAGGCGTCTAGCAAGCATGTCGAGGAGGAGCACCACGACGACGACGACGACGAGGACAATGAC
AACGAGGACGAGACTCAGCCCGTGTTTGTGCTTGATGAGCCATATGAGCAGCAACAGAAACAGGAACAACAAGCA
CCCGACGACGACAAGTTGCCGCCGCCGCCGCCACCGCCGCAGCAAACAAGACAGGTCGGCCAAGTGCCAATGAGC
GACGACGACGACGGGCCCAGCTCAAGTCTCCCGCGGCACAATGAAGAGGGCAAGAAGAGCGGCACGATGCGCGCG
CGGAACGGAAAGGTGGGCAGGACGATTCTCAATGGCATCATGCGCATTGGCGGCCGCTCCGAGAGCCCGGATGCC
AAGCATCGTTGA
Gene >OphauG2|791
ATGTCATCCTCGGCAATGCAAGAACAGGCCACCCCTTCTTTCCCAGGACGAGGTGGCCAGAAATCCAGAGACCGG
ACGCGAAGTCGCCAAGCTCCTTTTCCCCAGTACCAAGAACCTTGTCCGAACCGCCCTCGCATCTCTCAGAGCCTC
TCACACCAACACCTGCCCCAACTGACGTCCTCGTCGCTTGACTCTGCCCAAGACTTAAAATCTGAGCGCCCCAGT
GCTTCAACCTTGCGCTCTGCCTTTCGAACCGGCAGTGAGTCGGCTGGCACTAGCCACACTCTGACTCCCGATAGC
GCCACTAGTCGCGCTACAGGGTCAAGTGCTTTGAGCCTTGGTTCCGCTGCAGTCTCTCCCCGACTTGTCCCCCGT
GATGCTGGGTCTTCGCCCCATCACATGGCTTCATTGAGGATTGCCCATGGCCCAAGCGGCGGGAGACGCCAAGGC
ATGGTATTTGGCGAATCCTTTGGCAGGTCATGCGACAATTTCGAGTTTAGCACTGCGCCTACTACCCCTACTTCG
CCTCATCGTCAGCAGCACCAGTCTTCCCATGGCCGCAGCCAGCAAAGGGGCGCCAGTGTCACCATGAGACCCAGG
ACCCGAACCCTCGATGGTACCATGTTGAAGCAGAGAGCCACACCGCCTCCTGGCTCCGATAAGCCCTCCCATAAT
CGGGTCGGAAGCCTTGGCTCTTCCTCTGGAGCGCCAACGAAACTTGAAGAGCCACAACGATCATGCTACCGTGAG
CTGACAGGAGGCGCATCAAATACCTTGCCTAAGCGCACACTAGGCCCCCATACTATTAATGTCGACGACGCAAAC
TATCGTGTCTCCAGCTGGCTACCGACATCGCGTCCATCTTCGCCGTCCTTGAATGGTGTAGTGTCGGTCGATTCC
CTGCCAGTTCCAATGCCAACAAGGGACCCAGAGACCATCATCTCCCTAATGCAAACGCTGAATGGCAGGATGCAC
GGAGAGGTAGAATTTCAGACTGACACTGGAGGAGACTGGATCAATGGCTACGCCTACATTGACGATGACAACTGC
AGTCTCCTTTGGGAGAGTGCGCCAGAAAATGGAGCCGACCCCTTTCCTCAGCTCATTCCCGACCTCCGAGGATGT
AGAGTTTTGCTTGGAGAGCACCCCAAGTCTTGCAAGGCTTGTTTTGAACTCGTCTTCACCGTTCAGCACGCGGCG
CATGTTGGAGAGACGTCAATTTTATTGCTACGACCCATGGCTTCCGACGAATGGGATCATTGGCTCGCTGCACTC
TTAACTTGGCAACAGACTCGACAAGCGCCCAGCAAGAGCATTGGCGGTGGCGGCGCCGTTGCGGGTGTTGCTGTG
TGTGGAAGCTCTTCGAGCAGCCCTGTGGTGCCTAGCAGACCACATTTGCGGAGACAGGCACAGTCGGCCGTGTCG
GAAAATGGGCGCGGGTCCAACATCATCAAGGTTGGAACGGTCAAGCTGTGGAACAAGGATCCGCCAATGACCCCA
CCCGAAATATTTCGACGTCTCTCGACTGAAAAGCCACGCAGGGGCGAGGATACCTCTTGGACAAGAGTATCGTGC
ATCCTTCACGAGGATGGCGAGTTTAGGCTGCTCATGGAAAACGATATATCAGCGCTGGCAGTCATTCAACTGTCC
CAATTGTCACGGTGCGCCATTCAGCAACTCGACTGCACCGTGCTCGAGGAAGAATTCTGCATTGCAATCTTTCCC
ATGTATGCGCCTTCAGCCACGCACATGTCAATTTACCGTCCAGTATATCTTGCCTTGGACAGCCGAGTAGCCTTT
GAAGTATGGTTTGTGCTGTTTCGGGCCTTTGCAGTCCCCGAGATCTACAGGCTAGGTGGCGCCGACAATGCTTCC
ATTGAGGAGGTTGAAGAATTGGACCAAGAGGGGGCGGGAGAATTGTTCCGAGTATACAAGACGATTGTTGTCAGG
CTTACCGAGGCCAAGATTACGGGCCAGCCGCCATTGGCAGTGGAACCCGTAAGGACCAGTCTTGTCGAAAAGGGC
ACACCCAAGCCGGATCCTGACCGGTCGATTGGAAACTATTGGGCTGAGCTCATGCTCAATGGCGAAGTGCGAGCA
AGAACCACAACAAAATCAGACACCAATAATCCTTATTGGCGAGAGGAATGCGATTTTACAGACGTGCCTCAATCG
GTAAAAAAGTTGCTAATTGTCATCAAGCGTCTTGAAGGATTACCACCAGTTCAAACTCCCAAGGCAACGGGAAAA
AAGGCACCTTCGTCACCACCATCACCTAAATTTTTGCCCAAGGAAGTTGTTTGCGGAACTGTGAGCATCATGTTG
GATGAATTCAAACGCGACGAGGACCGCGAAGAGTGGTTTCAAATCCTGGACGACAAGGCTCAGCCGATTGGATCG
ATGCTGGTCAAGATATCATATGCTGAACACGTTGCATTGTTGAGCAAGGAATACGATGCGTTTTCCGACCTCCTT
CATAGATTTTCCACCAAGCTTACAACTCTAATATCGGCAGCCTTGCCGGGACAGCTTCGCCGGTTGTCCGAGACA
TTTGTTAATATATTTCAAGCATCTGGAACGGCTAGCGACTGGCTCATGGCACTGATTGACGACGAGATTGACGGG
ATCGGAAGCCAGTCGTCCTTCAACAAGCTTCGATTTAGTGGACGACTAAAGTCTGCGGAATCGTTCGAGTCATCA
TCTACAACTGCTACGGCGCGAGAGTTGCTGGTGCGCGACATGACACGGTCGCTGGCTGGCGAGGCCAATTTGCTC
TTTCGGGGAAACACACTGCTCACATTGTCGCTCGAGTTCCACATGCGCAGATTGGGAGCCGAGTATCTGCAAGAA
GTGCTGCGCGACAAGATTGTCCAGCTGGACAAGATGGACGTGGACTGCGAGGTGGATCCGAGCCGGCTGCCCCAT
CTTGGCCACAGTAGTCACCACCAACATCAGTTTTCTGCAGAGCTCGACCAACGCTGGAGCTGGCTCCTCCTACAG
ACGACGGAAATATGGCGGTGCATTTCCGAGTCGGCGGACCGACTGCCGGCAGAGCTGAGACATATTCTCAAATTT
GTTCGAGCTGTTGCTGAAGACCGATATGGCGATTTCGTCCGCGCACCAACCTATACCGCCGTGTCGGGCTTCTTG
TTTCTGCGTTTTCTATGTCCAGCGATTTTGTCTCCAAAGCTGTTTGGCCTGTTGCGAGACCACCCCAGGCCGCTG
ACGCAGCGCTCACTAACCTTGATTGCAAAAGTGCTGCAAAAAATGGCCAACCAGTCCACCTTTGGCAAGCGCGAG
CAGTGGATGGAGCCGATGAACAAGTTTTTAGCAGCCCAACGCTTCGTCTTTCGCGACTTTATCGACAAGGTGTGC
GAGATTCCCGGGTCTGATAGCAGCTTGATCAAGAGCGTACCGGCAAGCTACAGCACGCCTGCGACCATGGTGGGC
CGCCTGGGCTTGATGGCTCGAGAAGGCTTCCCCAGCCTGCCATATCTGATTGACCAGACACACAGCTTTGCCGTT
CTTGTCAAGCTGTGGACTGTGGCGCACCCGCAAGAAATCATGGCGGGCACCGACGACGCCGATGTGGAGCTGGCG
AGCTTTGACGCCATGTGTCGCAAACTGCAGCGGCGCACCGACGCGTGCTTGGAGAAGATGGACCGTGGCCGCGCA
GAAGCAGTGAGCAAGGCGTCTAGCAAGCATGTCGAGGAGGAGCACCACGACGACGACGACGACGAGGACAATGAC
AACGAGGACGAGACTCAGCCCGTGTTTGTGCTTGATGAGCCATATGAGCAGCAACAGAAACAGGAACAACAAGCA
CCCGACGACGACAAGTTGCCGCCGCCGCCGCCACCGCCGCAGCAAACAAGACAGGTCGGCCAAGTGCCAATGAGC
GACGACGACGACGGGCCCAGCTCAAGTCTCCCGCGGCACAATGAAGAGGGCAAGAAGAGCGGCACGATGCGCGCG
CGGAACGGAAAGGTGGGCAGGACGATTCTCAATGGCATCATGCGCATTGGCGGCCGCTCCGAGAGCCCGGATGCC
AAGCATCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail