Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7905
Gene name
LocationContig_973:257..2002
Strand-
Gene length (bp)1745
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08606 Prp19 Prp19/Pso4-like 1.5E-30 66 131
PF00400 WD40 WD domain, G-beta repeat 3.0E-02 314 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14011|PRP19_SCHPO Pre-mRNA-processing factor 19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp19 PE=1 SV=1 1 472 1.0E-72
sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1 1 484 5.0E-70
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 1 486 1.0E-69
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 1 465 5.0E-68
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 1 478 8.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14011|PRP19_SCHPO Pre-mRNA-processing factor 19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp19 PE=1 SV=1 1 472 1.0E-72
sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1 1 484 5.0E-70
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 1 486 1.0E-69
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 1 465 5.0E-68
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 1 478 8.0E-68
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 1 465 1.0E-67
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 1 471 2.0E-67
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 1 471 2.0E-67
sp|Q7KWK5|PRP19_DICDI Pre-mRNA-processing factor 19 OS=Dictyostelium discoideum GN=prp19 PE=3 SV=1 1 436 1.0E-66
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 1 471 2.0E-65
sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 1 471 2.0E-56
sp|P32523|PRP19_YEAST Pre-mRNA-processing factor 19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP19 PE=1 SV=2 1 131 4.0E-20
sp|Q09150|REC14_SCHPO Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1 203 378 1.0E-09
sp|P33215|NEDD1_MOUSE Protein NEDD1 OS=Mus musculus GN=Nedd1 PE=1 SV=2 211 381 2.0E-06
sp|Q9Y1C1|EMAP_LYTVA 77 kDa echinoderm microtubule-associated protein (Fragment) OS=Lytechinus variegatus GN=EMAP PE=2 SV=1 248 410 2.0E-06
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 209 370 3.0E-06
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 209 370 3.0E-06
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 209 370 3.0E-06
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 209 370 3.0E-06
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 267 381 9.0E-06
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 216 446 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7905
MLCAISGEAPQEPVVSKKSGIVYEKRLIQQYIGEHGTEPGSGDALVAEDLLPIKSAAIVRPRPPTLTSIPALLAT
FQTEWDSLALETYNLREQLSRTREELATALYQHDAAVRVIARLSRERDEARHSLSKVTVIENDANGDKMMLDNVE
ILPEALAARVDELHRSLSQERKGRAIPEEWVTPQEVSAFESIMSNPLSLARVNCLTLKGEFVALGDAKGEVSIYS
LSSDAMVRQMSLGEPVTDVLWVGEKFYFTTTLGSIKVFEGGEMLASLSEHTGPATGLSMHPGGEILASVGTDKSI
VFYETDTFTRLSRVHNDHALTTCAFHPDGHLFATGDVSGDVRLFRTTTLEQAASYQFDGPIQAISFSEKGFWLAT
AVKGKSAVTMTDLRKSGPAASKELEASGPVLTLDWDYTGQFLAAGSDSGLTVHQYTRSTKQWNEIFRDSVPTSLV
RWGTEGKKLVSVNEDGAVIVFGPPEEEEEEEPPQPNGDEAQEEEEEEEEEE*
Coding >OphauG2|7905
ATGCTTTGCGCAATCTCTGGCGAGGCGCCGCAAGAGCCCGTCGTGTCCAAAAAGTCGGGCATTGTTTACGAGAAA
CGCCTCATCCAACAGTACATCGGCGAGCATGGCACAGAGCCCGGCAGCGGCGACGCCCTCGTCGCTGAGGACCTC
CTGCCCATCAAGTCGGCTGCCATTGTCCGCCCTCGCCCTCCAACACTGACCTCGATCCCTGCTCTTCTTGCCACC
TTCCAGACCGAGTGGGACTCTCTTGCGCTCGAGACGTATAATCTCAGGGAGCAGCTATCACGGACGCGGGAAGAG
CTAGCCACAGCCCTTTATCAACACGACGCTGCAGTCCGTGTCATTGCTCGTCTTTCACGAGAGCGAGACGAAGCA
AGGCATTCTTTAAGCAAAGTAACAGTGATAGAAAACGACGCCAACGGAGACAAAATGATGCTCGATAATGTTGAG
ATTCTTCCCGAGGCCTTGGCCGCCCGGGTAGACGAACTCCACCGAAGTCTTTCCCAAGAACGAAAGGGGCGAGCC
ATTCCCGAGGAATGGGTCACCCCCCAAGAGGTTTCAGCCTTTGAGTCCATCATGTCCAACCCACTATCCTTGGCA
CGAGTCAACTGCCTCACGCTTAAGGGCGAGTTTGTGGCTTTGGGCGACGCTAAGGGCGAGGTCTCCATATACTCC
CTCTCTTCTGATGCTATGGTGCGTCAGATGTCTCTGGGCGAACCCGTTACGGATGTCCTCTGGGTCGGAGAAAAA
TTCTACTTCACCACAACTCTGGGAAGCATCAAGGTGTTTGAAGGCGGGGAAATGTTGGCATCTCTTTCTGAGCAC
ACTGGCCCCGCCACTGGCTTGAGCATGCATCCGGGCGGCGAGATTCTGGCCTCGGTCGGAACTGACAAGAGCATC
GTGTTCTACGAGACGGACACGTTTACACGCCTCAGCCGTGTCCACAATGACCACGCCCTTACGACATGTGCCTTC
CACCCCGATGGACACTTGTTTGCTACGGGTGATGTTTCTGGAGACGTCAGACTTTTCAGAACAACCACCCTGGAG
CAGGCTGCCAGCTATCAATTCGATGGACCGATACAGGCTATCTCCTTCTCAGAAAAGGGCTTTTGGCTGGCAACA
GCGGTCAAGGGAAAGAGTGCAGTCACCATGACTGATCTAAGAAAATCAGGCCCTGCTGCAAGCAAGGAACTGGAA
GCAAGCGGACCAGTGCTGACTTTGGACTGGGACTACACGGGCCAGTTTCTGGCTGCAGGAAGCGATTCAGGGCTG
ACTGTGCACCAATACACCAGATCTACTAAGCAATGGAACGAGATATTCCGAGATTCGGTGCCTACGTCATTGGTA
CGGTGGGGCACTGAAGGCAAGAAGTTGGTTTCTGTCAATGAGGATGGCGCCGTGATCGTGTTTGGCCCCCCGGAG
GAAGAGGAAGAGGAGGAGCCGCCGCAGCCGAATGGGGACGAGGCGCAAGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGTAA
Transcript >OphauG2|7905
ATGCTTTGCGCAATCTCTGGCGAGGCGCCGCAAGAGCCCGTCGTGTCCAAAAAGTCGGGCATTGTTTACGAGAAA
CGCCTCATCCAACAGTACATCGGCGAGCATGGCACAGAGCCCGGCAGCGGCGACGCCCTCGTCGCTGAGGACCTC
CTGCCCATCAAGTCGGCTGCCATTGTCCGCCCTCGCCCTCCAACACTGACCTCGATCCCTGCTCTTCTTGCCACC
TTCCAGACCGAGTGGGACTCTCTTGCGCTCGAGACGTATAATCTCAGGGAGCAGCTATCACGGACGCGGGAAGAG
CTAGCCACAGCCCTTTATCAACACGACGCTGCAGTCCGTGTCATTGCTCGTCTTTCACGAGAGCGAGACGAAGCA
AGGCATTCTTTAAGCAAAGTAACAGTGATAGAAAACGACGCCAACGGAGACAAAATGATGCTCGATAATGTTGAG
ATTCTTCCCGAGGCCTTGGCCGCCCGGGTAGACGAACTCCACCGAAGTCTTTCCCAAGAACGAAAGGGGCGAGCC
ATTCCCGAGGAATGGGTCACCCCCCAAGAGGTTTCAGCCTTTGAGTCCATCATGTCCAACCCACTATCCTTGGCA
CGAGTCAACTGCCTCACGCTTAAGGGCGAGTTTGTGGCTTTGGGCGACGCTAAGGGCGAGGTCTCCATATACTCC
CTCTCTTCTGATGCTATGGTGCGTCAGATGTCTCTGGGCGAACCCGTTACGGATGTCCTCTGGGTCGGAGAAAAA
TTCTACTTCACCACAACTCTGGGAAGCATCAAGGTGTTTGAAGGCGGGGAAATGTTGGCATCTCTTTCTGAGCAC
ACTGGCCCCGCCACTGGCTTGAGCATGCATCCGGGCGGCGAGATTCTGGCCTCGGTCGGAACTGACAAGAGCATC
GTGTTCTACGAGACGGACACGTTTACACGCCTCAGCCGTGTCCACAATGACCACGCCCTTACGACATGTGCCTTC
CACCCCGATGGACACTTGTTTGCTACGGGTGATGTTTCTGGAGACGTCAGACTTTTCAGAACAACCACCCTGGAG
CAGGCTGCCAGCTATCAATTCGATGGACCGATACAGGCTATCTCCTTCTCAGAAAAGGGCTTTTGGCTGGCAACA
GCGGTCAAGGGAAAGAGTGCAGTCACCATGACTGATCTAAGAAAATCAGGCCCTGCTGCAAGCAAGGAACTGGAA
GCAAGCGGACCAGTGCTGACTTTGGACTGGGACTACACGGGCCAGTTTCTGGCTGCAGGAAGCGATTCAGGGCTG
ACTGTGCACCAATACACCAGATCTACTAAGCAATGGAACGAGATATTCCGAGATTCGGTGCCTACGTCATTGGTA
CGGTGGGGCACTGAAGGCAAGAAGTTGGTTTCTGTCAATGAGGATGGCGCCGTGATCGTGTTTGGCCCCCCGGAG
GAAGAGGAAGAGGAGGAGCCGCCGCAGCCGAATGGGGACGAGGCGCAAGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGTAA
Gene >OphauG2|7905
ATGCTTTGCGCAAGTAAGTCCAGCCTCGTGCCCCAGGCGCCCCCAAACTCTTGCATTGACGCAGCCTGCACAGTC
TCTGGCGAGGCGCCGCAAGAGCCCGTCGTGTCCAAAAAGTCGGGTAGGTCCAACTTTGGCTCAAGAGCTCCATGG
CAACTCGACCCGGCCAGCAGCTAACCCCGCCAACCCAGGCATTGTTTACGAGAAACGCCTCATCCAACAGTACAT
CGGCGAGCATGGCACAGAGCCCGGCAGCGGCGACGCCCTCGTCGCTGAGGACCTCCTGCCCATCAAGTCGGCTGC
CATTGTCCGCCCTCGCCCTCCAACACTGACCTCGATCCCTGCTCTTCTTGCCACCTTCCAGACCGAGTGGGACTC
TCTTGCGCTCGAGACGTATAATCTCAGGGAGCAGCTATCACGGACGCGGGAAGAGCTAGCCACAGCCCTTTATCA
ACACGACGCTGCAGTCCGTGTCATTGCTCGTCTTTCACGAGAGCGAGACGAAGCAAGGCATTCTTTAAGCAAAGT
AACAGTGATAGAAAACGACGCCAACGGAGACAAAATGATGCTCGATAATGTTGAGATTCTTCCCGAGGCCTTGGC
CGCCCGGGTAGACGAACTCCACCGAAGGTGAGGGCTGCTCTCCAACACTCCCCATTACCCAAGCCGCTCACCAGT
CTCTAGTCTTTCCCAAGAACGAAAGGGGCGAGCCATTCCCGAGGAATGGGTCACCCCCCAAGAGGTTTCAGCCTT
TGAGTCCATCATGTCCAACCCACTATCCTTGGCACGAGTCAACTGCCTCACGCTTAAGGGCGAGTTTGTGGCTTT
GGGCGACGCTAAGGGCGAGGTCTCCATATACTCCCTCTCTTCTGATGCTATGGTGCGTCAGATGTCTCTGGGCGA
ACCCGTTACGGATGTCCTCTGGGTCGGAGAAAAATTCTACTTCACCACAACTCTGGGAAGCATCAAGGTGTTTGA
AGGCGGGGAAATGTTGGCATCTCTTTCTGAGCACACTGGCCCCGCCACTGGCTTGAGCATGCATCCGGGCGGCGA
GATTCTGGCCTCGGTCGGAACTGACAAGAGCATCGTGTTCTACGAGACGGACACGTTTACACGCCTCAGCCGTGT
CCACAATGACCACGGTAAGCCACTTGTCCATTTCATGGCTTTTTGGAGCACAATTTGCTGACCATGTAGCCCTTA
CGACATGTGCCTTCCACCCCGATGGACACTTGTTTGCTACGGGTGATGTTTCTGGAGACGTCAGACTTTTCAGAA
CAACCACCCTGGAGCAGGCTGCCAGCTATCAATTCGATGGACCGATACAGGCTATCTCCTTCTCAGAAAAGGGCT
TTTGGCTGGCAACAGCGGTCAAGGGAAAGAGTGCAGTCACCATGACTGATCTAAGAAAATCAGGCCCTGCTGCAA
GCAAGGAACTGGAAGCAAGCGGACCAGTGCTGACTTTGGACTGGGACTACACGGGCCAGTTTCTGGCTGCAGGAA
GCGATTCAGGGCTGACTGTGCACCAATACACCAGATCTACTAAGCAATGGAACGAGATATTCCGAGATTCGGTGC
CTACGTCATTGGTACGGTGGGGCACTGAAGGCAAGAAGTTGGTTTCTGTCAATGAGGATGGCGCCGTGATCGTGT
TTGGCCCCCCGGAGGAAGAGGAAGAGGAGGAGCCGCCGCAGCCGAATGGGGACGAGGCGCAAGAGGAGGAGGAGG
AGGAGGAGGAGGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail