Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7901
Gene name
LocationContig_971:4755..6586
Strand-
Gene length (bp)1831
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 8.9E-56 199 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 33 504 2.0E-168
sp|O94640|SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir2 PE=1 SV=2 105 475 1.0E-97
sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 103 479 3.0E-92
sp|P33294|SIR2_KLULA NAD-dependent histone deacetylase SIR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIR2 PE=3 SV=2 161 528 5.0E-92
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 161 479 3.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 33 504 2.0E-168
sp|O94640|SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir2 PE=1 SV=2 105 475 1.0E-97
sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 103 479 3.0E-92
sp|P33294|SIR2_KLULA NAD-dependent histone deacetylase SIR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIR2 PE=3 SV=2 161 528 5.0E-92
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 161 479 3.0E-91
sp|P53685|HST1_YEAST NAD-dependent protein deacetylase HST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST1 PE=1 SV=1 161 479 6.0E-90
sp|Q757M7|SIR2_ASHGO NAD-dependent histone deacetylase SIR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIR2 PE=3 SV=1 161 483 1.0E-88
sp|P06700|SIR2_YEAST NAD-dependent histone deacetylase SIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIR2 PE=1 SV=1 161 479 8.0E-88
sp|Q923E4|SIR1_MOUSE NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus GN=Sirt1 PE=1 SV=2 118 517 7.0E-75
sp|Q96EB6|SIR1_HUMAN NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens GN=SIRT1 PE=1 SV=2 118 529 2.0E-73
sp|Q9VK34|SIR2_DROME NAD-dependent histone deacetylase Sir2 OS=Drosophila melanogaster GN=Sir2 PE=1 SV=1 124 473 2.0E-71
sp|O59923|SIR2_CANAL NAD-dependent histone deacetylase SIR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIR2 PE=1 SV=2 183 479 2.0E-69
sp|Q60L58|SIR2_CAEBR NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis briggsae GN=sir-2.1 PE=3 SV=1 70 473 1.0E-65
sp|Q21921|SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans GN=sir-2.1 PE=1 SV=1 123 473 5.0E-65
sp|Q54GV7|SIR2D_DICDI NAD-dependent deacetylase sir2D OS=Dictyostelium discoideum GN=sir2D PE=2 SV=1 134 475 2.0E-61
sp|Q5AW69|HST21_EMENI NAD-dependent protein deacetylase hst2-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7461 PE=3 SV=1 192 475 7.0E-53
sp|Q9I7I7|SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster GN=Sirt2 PE=3 SV=1 192 475 7.0E-48
sp|Q9USN7|HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst2 PE=3 SV=1 166 475 7.0E-47
sp|Q54P49|SIR2C_DICDI NAD-dependent deacetylase sir2C OS=Dictyostelium discoideum GN=sir2C PE=2 SV=1 190 475 8.0E-47
sp|Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens GN=SIRT3 PE=1 SV=2 180 475 2.0E-46
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 189 475 6.0E-46
sp|P0CS88|HST22_EMENI NAD-dependent protein deacetylase hst2-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11873 PE=3 SV=1 194 496 1.0E-45
sp|Q5RJQ4|SIR2_RAT NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus GN=Sirt2 PE=1 SV=1 190 482 3.0E-45
sp|Q8R104|SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus GN=Sirt3 PE=1 SV=2 180 475 1.0E-44
sp|Q8VDQ8|SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus GN=Sirt2 PE=1 SV=2 190 525 3.0E-43
sp|Q5A985|HST2_CANAL NAD-dependent protein deacetylase HST2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST2 PE=3 SV=1 180 473 5.0E-43
sp|Q4R834|SIR2_MACFA NAD-dependent protein deacetylase sirtuin-2 OS=Macaca fascicularis GN=SIRT2 PE=2 SV=1 190 475 7.0E-43
sp|Q25337|SIR2_LEIMA NAD-dependent protein deacetylase SIR2rp1 OS=Leishmania major GN=SIR2rp1 PE=2 SV=2 192 454 2.0E-42
sp|Q5RBF1|SIR2_PONAB NAD-dependent protein deacetylase sirtuin-2 OS=Pongo abelii GN=SIRT2 PE=2 SV=1 190 475 3.0E-42
sp|Q8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens GN=SIRT2 PE=1 SV=2 190 475 3.0E-42
sp|Q7ZVK3|SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio GN=sirt2 PE=2 SV=1 187 459 3.0E-41
sp|Q57V41|SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp1 PE=1 SV=1 194 450 1.0E-40
sp|P53686|HST2_YEAST NAD-dependent protein deacetylase HST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST2 PE=1 SV=1 194 450 7.0E-33
sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 179 473 7.0E-28
sp|Q8R984|NPD2_CALS4 NAD-dependent protein deacetylase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB2 PE=3 SV=1 179 429 7.0E-25
sp|O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB2 PE=1 SV=1 179 473 2.0E-24
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 181 473 1.0E-22
sp|Q7P1B9|NPD_CHRVO NAD-dependent protein deacetylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cobB PE=3 SV=1 186 431 8.0E-22
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 192 445 2.0E-21
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 188 473 7.0E-21
sp|Q8ZU41|NPD1_PYRAE NAD-dependent protein deacetylase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB1 PE=3 SV=1 179 431 1.0E-20
sp|Q8ZT00|NPD2_PYRAE NAD-dependent protein deacylase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB2 PE=3 SV=1 183 431 6.0E-20
sp|Q3ZBQ0|SIR5_BOVIN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Bos taurus GN=SIRT5 PE=2 SV=1 158 468 3.0E-19
sp|E2RDZ6|SIR5_CANLF NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Canis lupus familiaris GN=SIRT5 PE=3 SV=1 179 468 5.0E-19
sp|O07595|NPD_BACSU NAD-dependent protein deacetylase OS=Bacillus subtilis (strain 168) GN=cobB PE=3 SV=1 187 448 4.0E-18
sp|Q68FX9|SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus GN=Sirt5 PE=2 SV=1 179 468 4.0E-18
sp|Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cobB PE=1 SV=1 181 431 8.0E-18
sp|Q8K2C6|SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus GN=Sirt5 PE=1 SV=1 179 455 2.0E-17
sp|Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio GN=sirt5 PE=1 SV=1 174 456 3.0E-17
sp|F7DKV7|SIR5_XENTR NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Xenopus tropicalis GN=sirt5 PE=3 SV=1 179 455 3.0E-17
sp|Q5R6G3|SIR5_PONAB NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Pongo abelii GN=SIRT5 PE=2 SV=1 179 471 3.0E-17
sp|Q5JG47|NPD_THEKO NAD-dependent protein deacylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cobB PE=3 SV=1 184 473 4.0E-17
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 168 475 4.0E-17
sp|Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens GN=SIRT5 PE=1 SV=2 179 468 6.0E-17
sp|F7EZ75|SIR5_MACMU NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Macaca mulatta GN=SIRT5 PE=3 SV=1 179 471 8.0E-17
sp|Q5KZE8|NPD2_GEOKA NAD-dependent protein deacetylase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB2 PE=3 SV=1 186 337 1.0E-16
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 185 466 1.0E-16
sp|Q5HZN8|SIR5A_XENLA NAD-dependent protein deacylase sirtuin-5A, mitochondrial OS=Xenopus laevis GN=sirt5-a PE=2 SV=1 166 455 1.0E-16
sp|E1BRE2|SIR5_CHICK NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Gallus gallus GN=SIRT5 PE=3 SV=1 179 455 2.0E-16
sp|Q68F47|SIR5B_XENLA NAD-dependent protein deacylase sirtuin-5B, mitochondrial OS=Xenopus laevis GN=sirt5-b PE=2 SV=1 186 455 2.0E-15
sp|Q81NT6|NPD_BACAN NAD-dependent protein deacetylase OS=Bacillus anthracis GN=cobB PE=3 SV=1 187 429 2.0E-15
sp|Q67KQ0|NPD_SYMTH NAD-dependent protein deacetylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cobB PE=3 SV=1 181 431 3.0E-15
sp|Q639M6|NPD_BACCZ NAD-dependent protein deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=cobB PE=3 SV=1 187 429 4.0E-15
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 187 429 5.0E-15
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 187 429 6.0E-15
sp|Q9I4E1|NPD2_PSEAE NAD-dependent protein deacylase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB2 PE=3 SV=1 178 432 1.0E-14
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 181 425 1.0E-14
sp|Q8NSM4|NPD_CORGL NAD-dependent protein deacylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cobB PE=3 SV=1 180 431 2.0E-14
sp|Q974M6|NPD_SULTO NAD-dependent protein deacetylase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cobB PE=3 SV=2 182 431 2.0E-14
sp|Q4JBN2|NPD_SULAC NAD-dependent protein deacetylase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cobB PE=3 SV=2 186 431 3.0E-14
sp|Q6HH09|NPD_BACHK NAD-dependent protein deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cobB PE=3 SV=1 187 429 4.0E-14
sp|Q71W25|NPD_LISMF NAD-dependent protein deacetylase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cobB PE=3 SV=1 179 434 8.0E-14
sp|A8MBU4|NPD_CALMQ NAD-dependent protein deacetylase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=cobB PE=3 SV=1 184 431 1.0E-13
sp|C6A243|NPD_THESM NAD-dependent protein deacylase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=cobB PE=3 SV=1 181 431 1.0E-13
sp|Q9YB13|NPD_AERPE NAD-dependent protein deacylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cobB PE=3 SV=2 180 427 1.0E-13
sp|Q8IRR5|SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster GN=Sirt4 PE=2 SV=2 187 398 1.0E-13
sp|B5YJW3|NPD_THEYD NAD-dependent protein deacetylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cobB PE=3 SV=1 175 431 1.0E-13
sp|Q88BY5|NPD_PSEPK NAD-dependent protein deacylase OS=Pseudomonas putida (strain KT2440) GN=cobB PE=3 SV=1 184 337 2.0E-13
sp|O58669|NPD_PYRHO NAD-dependent protein deacylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cobB PE=3 SV=1 183 431 2.0E-13
sp|Q9RL35|NPD1_STRCO NAD-dependent protein deacetylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB1 PE=3 SV=1 190 413 4.0E-13
sp|C1DBX3|NPD_LARHH NAD-dependent protein deacetylase OS=Laribacter hongkongensis (strain HLHK9) GN=cobB PE=3 SV=1 191 339 4.0E-13
sp|Q9Y6E7|SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens GN=SIRT4 PE=1 SV=1 181 425 4.0E-13
sp|Q927A7|NPD_LISIN NAD-dependent protein deacetylase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cobB PE=3 SV=1 179 434 4.0E-13
sp|Q9UZE7|NPD_PYRAB NAD-dependent protein deacylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cobB PE=3 SV=1 181 431 5.0E-13
sp|Q8U1Q1|NPD_PYRFU NAD-dependent protein deacylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cobB PE=3 SV=2 186 431 5.0E-13
sp|Q5L014|NPD1_GEOKA NAD-dependent protein deacetylase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB1 PE=3 SV=1 188 314 5.0E-13
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 188 469 7.0E-13
sp|Q899G3|NPD_CLOTE NAD-dependent protein deacetylase OS=Clostridium tetani (strain Massachusetts / E88) GN=cobB PE=3 SV=1 186 434 7.0E-13
sp|O67919|NPD_AQUAE NAD-dependent protein deacylase OS=Aquifex aeolicus (strain VF5) GN=cobB PE=3 SV=1 193 431 7.0E-13
sp|Q839C6|NPD_ENTFA NAD-dependent protein deacetylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cobB PE=3 SV=1 183 449 9.0E-13
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 181 425 9.0E-13
sp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana GN=SRT1 PE=2 SV=1 181 431 1.0E-12
sp|B0RM75|NPD_XANCB NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cobB PE=3 SV=1 186 425 1.0E-12
sp|Q8TWG0|NPD_METKA NAD-dependent protein deacylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cobB PE=3 SV=1 183 431 1.0E-12
sp|Q97VX5|NPD_SULSO NAD-dependent protein deacetylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cobB PE=1 SV=1 188 431 2.0E-12
sp|Q6N6U0|NPD_RHOPA NAD-dependent protein deacetylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cobB PE=3 SV=1 179 347 2.0E-12
sp|Q8Y3U2|NPD_LISMO NAD-dependent protein deacetylase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cobB PE=3 SV=1 179 434 3.0E-12
sp|Q8PQK3|NPD_XANAC NAD-dependent protein deacetylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cobB PE=3 SV=2 187 425 4.0E-12
sp|Q9I4L0|NPD1_PSEAE NAD-dependent protein deacylase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB1 PE=3 SV=1 185 472 4.0E-12
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 169 432 6.0E-12
sp|Q89LY4|NPD1_BRADU NAD-dependent protein deacetylase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB1 PE=3 SV=1 187 429 8.0E-12
sp|B8ARK7|SIR1_ORYSI NAD-dependent protein deacetylase SRT1 OS=Oryza sativa subsp. indica GN=SRT1 PE=2 SV=1 178 431 8.0E-12
sp|Q8PDM9|NPD_XANCP NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cobB PE=3 SV=1 186 425 8.0E-12
sp|Q4UZX0|NPD_XANC8 NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cobB PE=3 SV=1 186 425 8.0E-12
sp|O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB1 PE=1 SV=1 182 473 8.0E-12
sp|F7D4X9|SIR5_MONDO NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Monodelphis domestica GN=SIRT5 PE=3 SV=1 161 314 1.0E-11
sp|Q8R9N6|NPD1_CALS4 NAD-dependent protein deacylase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB1 PE=3 SV=1 188 431 1.0E-11
sp|Q97MB4|NPD_CLOAB NAD-dependent protein deacetylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cobB PE=3 SV=1 181 453 1.0E-11
sp|A9SDL4|SIR5_PHYPA NAD-dependent protein deacylase OS=Physcomitrella patens subsp. patens GN=SRT1505 PE=3 SV=1 172 425 2.0E-11
sp|Q8ELR0|NPD_OCEIH NAD-dependent protein deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cobB PE=3 SV=1 188 314 3.0E-11
sp|Q8CNF4|NPD_STAES NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cobB PE=3 SV=1 187 433 4.0E-11
sp|Q20481|SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans GN=sir-2.3 PE=3 SV=1 179 453 4.0E-11
sp|Q88ZA0|NPD_LACPL NAD-dependent protein deacetylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cobB PE=3 SV=1 188 449 6.0E-11
sp|Q8XNS6|NPD_CLOPE NAD-dependent protein deacetylase OS=Clostridium perfringens (strain 13 / Type A) GN=cobB PE=3 SV=1 186 338 7.0E-11
sp|Q9VH08|SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster GN=Sirt6 PE=2 SV=1 186 431 8.0E-11
sp|Q5HM33|NPD_STAEQ NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cobB PE=3 SV=1 187 433 8.0E-11
sp|Q885X7|NPD2_PSESM NAD-dependent protein deacylase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB2 PE=3 SV=1 183 370 8.0E-11
sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2 181 316 9.0E-11
sp|Q72IV5|NPD_THET2 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=cobB PE=3 SV=1 181 431 1.0E-10
sp|E9GD30|SIR5_DAPPU NAD-dependent protein deacylase OS=Daphnia pulex GN=DAPPUDRAFT_195469 PE=3 SV=1 181 455 2.0E-10
sp|A9A0B2|NPD_DESOH NAD-dependent protein deacylase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=cobB PE=3 SV=1 179 431 2.0E-10
sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1 181 316 4.0E-10
sp|Q8FRV5|NPD2_COREF NAD-dependent protein deacylase 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB2 PE=3 SV=2 179 431 5.0E-10
sp|Q9VAQ1|SIR7_DROME NAD-dependent protein deacetylase Sirt7 OS=Drosophila melanogaster GN=Sirt7 PE=1 SV=2 181 477 6.0E-10
sp|Q8CJM9|NPD2_STRCO NAD-dependent protein deacetylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB2 PE=3 SV=1 194 329 7.0E-10
sp|Q8Y015|NPD_RALSO NAD-dependent protein deacylase OS=Ralstonia solanacearum (strain GMI1000) GN=cobB PE=3 SV=1 191 431 1.0E-09
sp|Q5SIH7|NPD_THET8 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=cobB PE=3 SV=1 181 431 1.0E-09
sp|Q20480|SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans GN=sir-2.2 PE=3 SV=1 179 313 4.0E-09
sp|Q95Q89|SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans GN=sir-2.4 PE=3 SV=2 176 366 5.0E-09
sp|A9UVV1|SIR4_MONBE NAD-dependent protein deacylase SIR4 OS=Monosiga brevicollis GN=15984 PE=3 SV=1 181 432 5.0E-09
sp|P66816|NPD_STAAN NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain N315) GN=cobB PE=3 SV=1 179 433 6.0E-09
sp|P66815|NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cobB PE=1 SV=1 179 433 6.0E-09
sp|Q8NVC8|NPD_STAAW NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MW2) GN=cobB PE=3 SV=1 179 433 6.0E-09
sp|Q6G7B7|NPD_STAAS NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MSSA476) GN=cobB PE=3 SV=1 179 433 6.0E-09
sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2 191 313 7.0E-09
sp|Q6A5T5|NPD_PROAC NAD-dependent protein deacetylase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=cobB PE=3 SV=1 188 344 7.0E-09
sp|Q6GEN2|NPD_STAAR NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MRSA252) GN=cobB PE=3 SV=1 186 433 9.0E-09
sp|Q8FUC8|NPD1_COREF NAD-dependent protein deacetylase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB1 PE=3 SV=2 180 432 9.0E-09
sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1 191 313 9.0E-09
sp|A0QDH4|NPD1_MYCA1 NAD-dependent protein deacetylase 1 OS=Mycobacterium avium (strain 104) GN=cobB1 PE=3 SV=1 185 425 1.0E-08
sp|Q53700|NPD_STAA8 NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain NCTC 8325) GN=cobB PE=3 SV=1 186 342 1.0E-08
sp|Q5HE07|NPD_STAAC NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain COL) GN=cobB PE=3 SV=1 186 342 2.0E-08
sp|Q72RR0|NPD_LEPIC NAD-dependent protein deacylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cobB PE=3 SV=1 190 342 2.0E-08
sp|Q8F3Z6|NPD_LEPIN NAD-dependent protein deacylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cobB PE=3 SV=1 190 342 3.0E-08
sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1 191 313 3.0E-08
sp|Q8IE47|SIR5_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) GN=Sir2A PE=1 SV=1 176 314 6.0E-08
sp|Q0P595|SIR7_BOVIN NAD-dependent protein deacetylase sirtuin-7 OS=Bos taurus GN=SIRT7 PE=2 SV=1 191 313 6.0E-08
sp|Q8REC3|NPD_FUSNN NAD-dependent protein deacetylase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cobB PE=3 SV=1 183 326 8.0E-08
sp|Q9KEE5|NPD_BACHD NAD-dependent protein deacetylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cobB PE=3 SV=1 188 429 4.0E-07
sp|Q5V4Q5|NPD_HALMA NAD-dependent protein deacetylase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cobB PE=3 SV=1 179 429 5.0E-07
sp|A8NWP2|SIR5_COPC7 NAD-dependent protein deacylase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00083 PE=3 SV=2 179 342 9.0E-07
sp|Q607X6|NPD_METCA NAD-dependent protein deacylase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cobB PE=3 SV=1 182 347 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0051287 NAD binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7901
MKRAAAAAAAGKGGGVKMQRRVKARADAFDKLPQNATLADIKKAEANVSLAELEERVNDVRESWETDSLFEDAIE
ELGAETTSSRSSSSSSGGSGSGVVDTCSPEEAARLRRELREYGPTVFSQRTVDAGRYSAKKLLSAFGIRPPAFLQ
GEGDAAYYSLLALAISRELSKRAKLTRYNSVDDAVQLLARSKHVIVITGAGISTSLGIPDFRSKGTGLYSKLEHL
GLGDPQQVFDIDVFKEDPSIFYSVARDIVPATDRFTPTHHFIAMLHARGKLLTNYSQNIDNLEVKAGVPRDRLVQ
CHGSFGTASCISCGLQTDGADILPDIRAGIIPRCRRCADAPRREASVKRKRAPAHRRSTRRRWSATGSDSDADDD
ADDAVPRAGVMKPDITFFGEALPVQFGQRLTEHDRDLVDLVLVIGTSLKVTPVSEIVSWLPPHIPQIYMSRQPVA
HINFDIDLLGDCDVVVAELARRLHWPLVHDMVPPDQDVVVRSDPASPSRHFFEVPDAPPPPPLLHQDQEQQQQQQ
QNTPLPDAQKSTSRRAARSSLASRAAKS*
Coding >OphauG2|7901
ATGAAGCGAGCAGCAGCAGCAGCAGCAGCAGGCAAGGGCGGCGGCGTCAAGATGCAGCGGCGGGTCAAGGCGCGG
GCAGACGCGTTTGACAAGCTGCCGCAGAATGCGACGCTGGCAGACATCAAAAAGGCCGAGGCAAACGTGTCGCTG
GCGGAGCTGGAGGAGCGGGTCAATGACGTGCGGGAGTCGTGGGAGACGGATAGCCTGTTTGAGGATGCGATTGAG
GAGCTGGGGGCGGAGACGACGAGCAGTCGGAGCAGCAGCAGCAGCAGCGGAGGGAGCGGGAGTGGTGTAGTTGAC
ACCTGCTCGCCCGAAGAGGCCGCTCGCCTTCGTCGTGAACTCCGGGAATACGGCCCCACCGTCTTCTCCCAGCGC
ACCGTCGACGCCGGGCGCTACTCGGCCAAGAAGCTGCTCAGCGCGTTTGGCATCCGCCCGCCCGCCTTTCTGCAG
GGCGAGGGCGACGCCGCCTACTACAGCCTGCTGGCGCTGGCGATATCGCGCGAGCTGTCCAAGCGCGCCAAGCTG
ACGCGCTACAACAGCGTCGACGATGCCGTGCAGCTGCTGGCGCGCAGCAAGCACGTCATTGTGATTACCGGCGCC
GGCATCTCCACGTCGCTCGGCATCCCCGACTTCCGCTCCAAGGGCACCGGGCTCTACTCCAAGCTCGAGCACCTG
GGCCTGGGCGACCCGCAGCAGGTGTTTGACATTGACGTGTTCAAGGAGGACCCGTCCATCTTCTACTCGGTGGCG
CGCGACATTGTGCCGGCCACGGACCGCTTCACGCCCACGCACCACTTCATCGCCATGCTGCACGCGCGCGGCAAG
CTGCTGACGAATTACTCGCAAAACATTGACAACCTCGAGGTCAAGGCCGGCGTGCCGCGCGACCGCCTGGTGCAG
TGCCACGGGTCCTTTGGCACCGCCAGCTGCATCTCGTGCGGCCTGCAGACCGACGGCGCCGACATTTTGCCCGAC
ATTCGCGCCGGCATCATCCCGCGCTGCCGCCGCTGTGCCGATGCGCCGCGGCGGGAGGCGTCGGTCAAGCGCAAA
CGCGCCCCCGCCCACCGCCGCAGCACCCGCCGCCGCTGGTCCGCCACCGGCTCCGACTCGGACGCCGACGACGAC
GCCGACGACGCCGTCCCGCGCGCCGGCGTCATGAAGCCCGACATTACCTTTTTCGGCGAGGCCCTGCCCGTGCAG
TTTGGCCAGCGCCTGACGGAGCACGACCGCGACCTGGTGGACCTGGTGCTCGTCATTGGCACCTCGCTCAAAGTC
ACCCCCGTCTCGGAAATCGTCAGCTGGCTGCCCCCGCACATTCCCCAGATCTACATGTCGCGCCAGCCCGTCGCC
CACATCAACTTTGACATTGACCTGCTTGGCGACTGCGACGTGGTTGTCGCCGAGCTGGCCCGCCGCCTGCACTGG
CCCCTGGTCCACGACATGGTGCCGCCCGACCAAGACGTCGTTGTGCGCTCCGACCCGGCCTCGCCCAGCCGCCAT
TTCTTCGAGGTGCCTGATGCTCCTCCTCCTCCTCCTCTGCTGCACCAAGATCAAGAGCAGCAGCAGCAGCAGCAG
CAGAACACTCCGCTGCCTGACGCCCAGAAATCCACGTCTAGACGCGCTGCCAGAAGCTCGCTTGCTTCTCGCGCC
GCCAAGTCGTGA
Transcript >OphauG2|7901
ATGAAGCGAGCAGCAGCAGCAGCAGCAGCAGGCAAGGGCGGCGGCGTCAAGATGCAGCGGCGGGTCAAGGCGCGG
GCAGACGCGTTTGACAAGCTGCCGCAGAATGCGACGCTGGCAGACATCAAAAAGGCCGAGGCAAACGTGTCGCTG
GCGGAGCTGGAGGAGCGGGTCAATGACGTGCGGGAGTCGTGGGAGACGGATAGCCTGTTTGAGGATGCGATTGAG
GAGCTGGGGGCGGAGACGACGAGCAGTCGGAGCAGCAGCAGCAGCAGCGGAGGGAGCGGGAGTGGTGTAGTTGAC
ACCTGCTCGCCCGAAGAGGCCGCTCGCCTTCGTCGTGAACTCCGGGAATACGGCCCCACCGTCTTCTCCCAGCGC
ACCGTCGACGCCGGGCGCTACTCGGCCAAGAAGCTGCTCAGCGCGTTTGGCATCCGCCCGCCCGCCTTTCTGCAG
GGCGAGGGCGACGCCGCCTACTACAGCCTGCTGGCGCTGGCGATATCGCGCGAGCTGTCCAAGCGCGCCAAGCTG
ACGCGCTACAACAGCGTCGACGATGCCGTGCAGCTGCTGGCGCGCAGCAAGCACGTCATTGTGATTACCGGCGCC
GGCATCTCCACGTCGCTCGGCATCCCCGACTTCCGCTCCAAGGGCACCGGGCTCTACTCCAAGCTCGAGCACCTG
GGCCTGGGCGACCCGCAGCAGGTGTTTGACATTGACGTGTTCAAGGAGGACCCGTCCATCTTCTACTCGGTGGCG
CGCGACATTGTGCCGGCCACGGACCGCTTCACGCCCACGCACCACTTCATCGCCATGCTGCACGCGCGCGGCAAG
CTGCTGACGAATTACTCGCAAAACATTGACAACCTCGAGGTCAAGGCCGGCGTGCCGCGCGACCGCCTGGTGCAG
TGCCACGGGTCCTTTGGCACCGCCAGCTGCATCTCGTGCGGCCTGCAGACCGACGGCGCCGACATTTTGCCCGAC
ATTCGCGCCGGCATCATCCCGCGCTGCCGCCGCTGTGCCGATGCGCCGCGGCGGGAGGCGTCGGTCAAGCGCAAA
CGCGCCCCCGCCCACCGCCGCAGCACCCGCCGCCGCTGGTCCGCCACCGGCTCCGACTCGGACGCCGACGACGAC
GCCGACGACGCCGTCCCGCGCGCCGGCGTCATGAAGCCCGACATTACCTTTTTCGGCGAGGCCCTGCCCGTGCAG
TTTGGCCAGCGCCTGACGGAGCACGACCGCGACCTGGTGGACCTGGTGCTCGTCATTGGCACCTCGCTCAAAGTC
ACCCCCGTCTCGGAAATCGTCAGCTGGCTGCCCCCGCACATTCCCCAGATCTACATGTCGCGCCAGCCCGTCGCC
CACATCAACTTTGACATTGACCTGCTTGGCGACTGCGACGTGGTTGTCGCCGAGCTGGCCCGCCGCCTGCACTGG
CCCCTGGTCCACGACATGGTGCCGCCCGACCAAGACGTCGTTGTGCGCTCCGACCCGGCCTCGCCCAGCCGCCAT
TTCTTCGAGGTGCCTGATGCTCCTCCTCCTCCTCCTCTGCTGCACCAAGATCAAGAGCAGCAGCAGCAGCAGCAG
CAGAACACTCCGCTGCCTGACGCCCAGAAATCCACGTCTAGACGCGCTGCCAGAAGCTCGCTTGCTTCTCGCGCC
GCCAAGTCGTGA
Gene >OphauG2|7901
ATGAAGCGAGCAGCAGCAGCAGCAGCAGCAGGCAAGGGCGGCGGCGTCAAGATGCAGCGGCGGGTCAAGGCGCGG
GCAGACGCGTTTGACAAGCTGCCGCAGAATGCGACGCTGGCAGACATCAAAAAGGCCGAGGCAAACGTGTCGCTG
GCGGAGCTGGAGGAGCGGGTCAATGACGTGCGGGAGTCGTGGGAGACGGATAGCCTGTTTGAGGATGCGATTGAG
GAGCTGGGGGCGGAGACGACGAGCAGTCGGAGCAGCAGCAGCAGCAGCGGAGGGAGCGGGAGTGGTGTAGTTGGT
GAGTTTTTTTTTCTCCCTCTCTCTCTCTCTCCCTCTCTCTCTTCTTTCCTCTTCTCTTCTTCCTCTCTCTCTTCC
TCTCTCTCTCTCTCTTCCTCCTCTCTCCTCTCTCCTCTCTTCTCACTCTCCTCCTCCTCCTCCTCTCTCTCTTCT
CTTCTCACTCTACCTAGACACCTGCTCGCCCGAAGAGGCCGCTCGCCTTCGTCGTGAACTCCGGGAATACGGCCC
CACCGTCTTCTCCCAGCGCACCGTCGACGCCGGGCGCTACTCGGCCAAGAAGCTGCTCAGCGCGTTTGGCATCCG
CCCGCCCGCCTTTCTGCAGGGCGAGGGCGACGCCGCCTACTACAGCCTGCTGGCGCTGGCGATATCGCGCGAGCT
GTCCAAGCGCGCCAAGCTGACGCGCTACAACAGCGTCGACGATGCCGTGCAGCTGCTGGCGCGCAGCAAGCACGT
CATTGTGATTACCGGCGCCGGCATCTCCACGTCGCTCGGCATCCCCGACTTCCGCTCCAAGGGCACCGGGCTCTA
CTCCAAGCTCGAGCACCTGGGCCTGGGCGACCCGCAGCAGGTGTTTGACATTGACGTGTTCAAGGAGGACCCGTC
CATCTTCTACTCGGTGGCGCGCGACATTGTGCCGGCCACGGACCGCTTCACGCCCACGCACCACTTCATCGCCAT
GCTGCACGCGCGCGGCAAGCTGCTGACGAATTACTCGCAAAACATTGACAACCTCGAGGTCAAGGCCGGCGTGCC
GCGCGACCGCCTGGTGCAGTGCCACGGGTCCTTTGGCACCGCCAGCTGCATCTCGTGCGGCCTGCAGACCGACGG
CGCCGACATTTTGCCCGACATTCGCGCCGGCATCATCCCGCGCTGCCGCCGCTGTGCCGATGCGCCGCGGCGGGA
GGCGTCGGTCAAGCGCAAACGCGCCCCCGCCCACCGCCGCAGCACCCGCCGCCGCTGGTCCGCCACCGGCTCCGA
CTCGGACGCCGACGACGACGCCGACGACGCCGTCCCGCGCGCCGGCGTCATGAAGCCCGACATTACCTTTTTCGG
CGAGGCCCTGCCCGTGCAGTTTGGCCAGCGCCTGACGGAGCACGACCGCGACCTGGTGGACCTGGTGCTCGTCAT
TGGCACCTCGCTCAAAGTCACCCCCGTCTCGGAAATCGTCAGCTGGCTGCCCCCGCACATTCCCCAGATCTACAT
GTCGCGCCAGCCCGTCGCCCACATCAACTTTGACATTGACCTGCTTGGCGACTGCGACGTGGTTGTCGCCGAGCT
GGCCCGCCGCCTGCACTGGCCCCTGGTCCACGACATGGTGCCGCCCGACCAAGACGTCGTTGTGCGCTCCGACCC
GGCCTCGCCCAGCCGCCATTTCTTCGAGGTGCCTGATGCTCCTCCTCCTCCTCCTCTGCTGCACCAAGATCAAGA
GCAGCAGCAGCAGCAGCAGCAGAACACTCCGCTGCCTGACGCCCAGAAATCCACGTCTAGACGCGCTGCCAGAAG
CTCGCTTGCTTCTCGCGCCGCCAAGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail