Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|789
Gene name
LocationContig_120:20378..21068
Strand-
Gene length (bp)690
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12824 MRP-L20 Mitochondrial ribosomal protein subunit L20 1.2E-48 35 224

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22354|RM20_YEAST 54S ribosomal protein L20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL20 PE=1 SV=2 142 226 6.0E-12
sp|O94723|RM20_SCHPO 54S ribosomal protein L20, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl20 PE=3 SV=1 74 221 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|789
MHHQSFARLASRRVATRPLAPSPTCCSVSVFLHPSRSYETAARTKRALKVAPHASFLPDRRPPSPFPREEHIIYN
PPASEASPVHTPFLFLPENDPRRVAMTRLRHEEELDTRSGQPPAADASNANAPSDLPPAMRYRRREQSYHLEEKE
MKEMRRLRTEDPVKWSVGQLAKKFNCSPVFVSMVAPAPPGHLTWLREKLDRKMQRWGPMKTQAREDRRRRAELLY
RGEL*
Coding >OphauG2|789
ATGCATCACCAGTCCTTTGCTCGTCTAGCATCACGACGCGTCGCAACTCGTCCTCTTGCTCCATCCCCGACATGT
TGCTCCGTCTCGGTTTTCCTGCATCCTTCACGAAGCTATGAAACAGCAGCACGAACCAAGCGTGCCCTCAAGGTT
GCTCCTCACGCATCCTTTCTCCCCGACAGACGACCTCCCTCTCCCTTTCCCCGAGAAGAGCACATCATTTACAAC
CCGCCCGCCTCGGAGGCGTCCCCAGTCCATACGCCATTTCTCTTTTTGCCTGAAAATGACCCGAGACGTGTAGCC
ATGACGCGGCTGCGCCATGAAGAAGAACTGGACACTCGATCCGGCCAACCCCCCGCTGCTGACGCCAGCAATGCT
AATGCTCCCAGCGACCTTCCGCCAGCAATGCGCTATCGTCGAAGAGAACAAAGCTACCATCTCGAGGAAAAAGAA
ATGAAGGAGATGCGTCGCCTGCGTACAGAGGACCCCGTCAAGTGGAGCGTGGGACAGCTTGCCAAAAAGTTCAAT
TGCTCGCCCGTGTTTGTTAGCATGGTGGCCCCCGCACCTCCTGGGCATCTGACGTGGTTACGAGAAAAGTTGGAT
CGGAAAATGCAACGATGGGGGCCGATGAAAACGCAGGCAAGGGAGGACCGCAGGCGAAGGGCAGAGCTGCTCTAT
CGCGGCGAGCTGTAA
Transcript >OphauG2|789
ATGCATCACCAGTCCTTTGCTCGTCTAGCATCACGACGCGTCGCAACTCGTCCTCTTGCTCCATCCCCGACATGT
TGCTCCGTCTCGGTTTTCCTGCATCCTTCACGAAGCTATGAAACAGCAGCACGAACCAAGCGTGCCCTCAAGGTT
GCTCCTCACGCATCCTTTCTCCCCGACAGACGACCTCCCTCTCCCTTTCCCCGAGAAGAGCACATCATTTACAAC
CCGCCCGCCTCGGAGGCGTCCCCAGTCCATACGCCATTTCTCTTTTTGCCTGAAAATGACCCGAGACGTGTAGCC
ATGACGCGGCTGCGCCATGAAGAAGAACTGGACACTCGATCCGGCCAACCCCCCGCTGCTGACGCCAGCAATGCT
AATGCTCCCAGCGACCTTCCGCCAGCAATGCGCTATCGTCGAAGAGAACAAAGCTACCATCTCGAGGAAAAAGAA
ATGAAGGAGATGCGTCGCCTGCGTACAGAGGACCCCGTCAAGTGGAGCGTGGGACAGCTTGCCAAAAAGTTCAAT
TGCTCGCCCGTGTTTGTTAGCATGGTGGCCCCCGCACCTCCTGGGCATCTGACGTGGTTACGAGAAAAGTTGGAT
CGGAAAATGCAACGATGGGGGCCGATGAAAACGCAGGCAAGGGAGGACCGCAGGCGAAGGGCAGAGCTGCTCTAT
CGCGGCGAGCTGTAA
Gene >OphauG2|789
ATGCATCACCAGTCCTTTGCTCGTCTAGCATCACGACGCGTCGCAACTCGTCCTCTTGCTCCATCCCCGACATGT
TGCTCCGTCTCGGTTTTCCTGCATCCTTCACGAAGCTATGAAACAGCAGCACGAACCAAGCGTGCCCTCAAGGTT
GCTCCTCACGCATCCTTTCTCCCCGACAGACGACCTCCCTCTCCCTTTCCCCGAGAAGAGCACATCATTTACAAC
CCGCCCGCCTCGGAGGCGTCCCCAGTCCATACGCCATTTCTCTTTTTGCCTGAAAATGACCCGAGACGTGTAGCC
ATGACGCGGCTGCGCCATGAAGAAGAACTGGACACTCGATCCGGCCAACCCCCCGCTGCTGACGCCAGCAATGCT
AATGCTCCCAGCGACCTTCCGCCAGCAATGCGCTATCGTCGAAGAGAACAAAGCTACCATCTCGAGGAAAAAGAA
ATGAAGGAGATGCGTCGCCTGCGTACAGAGGACCCCGTCAAGTGGAGCGTGGGACAGCTTGCCAAAAAGTTCAAT
TGCTCGCCCGTGTTTGTTAGCATGGTGGCCCCCGCACCTCCTGGGCATCTGACGTGGTTACGAGAAAAGTTGGAT
CGGAAAATGCAACGATGGGGGCCGATGAAAACGCAGGCAAGGGAGGACCGCAGGCGAAGGGCAGAGCTGCTCTAT
CGCGGCGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail