Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7886
Gene name
LocationContig_97:15832..16789
Strand-
Gene length (bp)957
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13911 AhpC-TSA_2 AhpC/TSA antioxidant enzyme 5.5E-13 92 186

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8AV19|AAED1_TAKRU Thioredoxin-like protein AAED1 OS=Takifugu rubripes GN=aaed1 PE=3 SV=1 25 186 2.0E-10
sp|Q7RTV5|AAED1_HUMAN Thioredoxin-like protein AAED1 OS=Homo sapiens GN=AAED1 PE=2 SV=1 27 244 2.0E-09
sp|Q9D1A0|AAED1_MOUSE Thioredoxin-like protein AAED1 OS=Mus musculus GN=Aaed1 PE=2 SV=1 27 244 3.0E-09
sp|Q148E0|AAED1_BOVIN Thioredoxin-like protein AAED1 OS=Bos taurus GN=AAED1 PE=2 SV=1 27 186 7.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1110
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7886 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6395
Ophiocordyceps camponoti-floridani Ophcf2|01985
Ophiocordyceps camponoti-rufipedis Ophun1|2788
Ophiocordyceps kimflemingae Ophio5|4024
Ophiocordyceps subramaniannii Hirsu2|10141

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7886
MGDTQELDFEGQVATSNALPSSETVESVKDYILLDKHGKSHPFWSLYSGRHVARRMLVIFVRHFFCGNCQEFLRS
LAESVTPDALLRLPISTFVVVIGCGDPALISMYTDATQCPFPIYTDPNHALFDALGMIKTLNLGDRPAYQRRSMV
TGIVASIGQALRYVPAGLALRSGDQRQVGGEFLFEPMDPVTPLDMADDEADCGLAGVETKGEPIETKRVTWCHRM
RTTRDHAEIPELMEVLGLDGQGEPIKDGKRWSKALNTRKGTGFTMANQMRRISETNMENAAIASADEA*
Coding >OphauG2|7886
ATGGGAGACACGCAGGAGCTGGATTTCGAGGGCCAGGTGGCCACGTCGAATGCGCTGCCATCGAGCGAGACGGTG
GAAAGCGTCAAGGACTATATTTTGCTTGACAAGCATGGAAAATCGCATCCGTTCTGGAGCCTATATAGCGGACGG
CATGTGGCGCGGCGGATGCTAGTCATTTTTGTGCGACACTTTTTCTGCGGCAACTGCCAGGAATTCCTGCGCTCC
CTGGCCGAGTCGGTGACACCCGACGCCCTACTCCGGCTGCCCATCAGCACCTTTGTAGTTGTGATTGGATGCGGA
GACCCGGCCCTCATCTCCATGTATACCGACGCAACGCAGTGTCCCTTTCCCATCTACACCGACCCCAACCACGCC
CTGTTTGACGCTCTCGGCATGATCAAGACGCTCAATCTCGGCGACCGCCCCGCCTATCAGCGCCGCAGCATGGTG
ACTGGCATCGTTGCGAGCATTGGACAGGCGCTGCGCTACGTGCCGGCCGGCCTGGCGCTGCGCTCGGGCGACCAG
CGGCAAGTCGGCGGCGAGTTTCTCTTTGAGCCCATGGATCCTGTGACGCCGCTCGACATGGCTGACGACGAGGCC
GACTGTGGGCTTGCGGGCGTCGAAACCAAGGGCGAGCCGATTGAGACAAAGAGAGTAACGTGGTGCCATCGAATG
CGGACGACGCGGGACCATGCCGAGATTCCGGAGCTCATGGAGGTGCTGGGCTTGGACGGCCAGGGCGAGCCCATC
AAGGACGGCAAGCGCTGGTCCAAGGCCTTGAACACGCGCAAAGGCACCGGCTTTACCATGGCCAACCAGATGCGG
CGAATCAGCGAGACAAACATGGAGAATGCCGCCATTGCCAGCGCCGACGAGGCATAG
Transcript >OphauG2|7886
ATGGGAGACACGCAGGAGCTGGATTTCGAGGGCCAGGTGGCCACGTCGAATGCGCTGCCATCGAGCGAGACGGTG
GAAAGCGTCAAGGACTATATTTTGCTTGACAAGCATGGAAAATCGCATCCGTTCTGGAGCCTATATAGCGGACGG
CATGTGGCGCGGCGGATGCTAGTCATTTTTGTGCGACACTTTTTCTGCGGCAACTGCCAGGAATTCCTGCGCTCC
CTGGCCGAGTCGGTGACACCCGACGCCCTACTCCGGCTGCCCATCAGCACCTTTGTAGTTGTGATTGGATGCGGA
GACCCGGCCCTCATCTCCATGTATACCGACGCAACGCAGTGTCCCTTTCCCATCTACACCGACCCCAACCACGCC
CTGTTTGACGCTCTCGGCATGATCAAGACGCTCAATCTCGGCGACCGCCCCGCCTATCAGCGCCGCAGCATGGTG
ACTGGCATCGTTGCGAGCATTGGACAGGCGCTGCGCTACGTGCCGGCCGGCCTGGCGCTGCGCTCGGGCGACCAG
CGGCAAGTCGGCGGCGAGTTTCTCTTTGAGCCCATGGATCCTGTGACGCCGCTCGACATGGCTGACGACGAGGCC
GACTGTGGGCTTGCGGGCGTCGAAACCAAGGGCGAGCCGATTGAGACAAAGAGAGTAACGTGGTGCCATCGAATG
CGGACGACGCGGGACCATGCCGAGATTCCGGAGCTCATGGAGGTGCTGGGCTTGGACGGCCAGGGCGAGCCCATC
AAGGACGGCAAGCGCTGGTCCAAGGCCTTGAACACGCGCAAAGGCACCGGCTTTACCATGGCCAACCAGATGCGG
CGAATCAGCGAGACAAACATGGAGAATGCCGCCATTGCCAGCGCCGACGAGGCATAG
Gene >OphauG2|7886
ATGGGAGACACGCAGGAGCTGGATTTCGAGGGCCAGGTGGCCACGTCGAATGCGCTGCCATCGAGCGAGACGGTG
GAAAGCGTCAAGGACTATATTTTGCTTGACAAGCATGGAAAATCGCATCCGTTCTGGAGCCTATATAGCGGACGG
CATGTGGCGCGGCGGATGCTAGTCATTTTTGTGCGACACTTTTTCTGCGGCGTAAGTTGCTGCGATGCTGGGATT
CCGGGGTGGGGAGAGAGGATTGCTGCTAATACAAATCTTGTACAATGCTAGAACTGCCAGGAATTCCTGCGCTCC
CTGGCCGAGTCGGTGACACCCGACGCCCTACTCCGGCTGCCCATCAGCACCTTTGTAGTTGTGATTGGATGCGGA
GACCCGGCCCTCATCTCCATGTATACCGACGCAACGCAGTGTCCCTTTCCCATCTACACCGACCCCAACCACGCC
CTGTTTGACGCTCTCGGCATGATCAAGACGCTCAATCTCGGCGACCGCCCCGCCTATCAGCGCCGCAGCATGGTG
ACTGGCATCGTTGCGAGCATTGGACAGGCGCTGCGCTACGTGCCGGCCGGCCTGGCGCTGCGCTCGGGCGACCAG
CGGCAAGTCGGCGGCGAGTTTCTCTTTGAGCCCATGGATCCTGTGACGCCGCTCGACATGGCTGACGACGAGGCC
GACTGTGGGCTTGCGGGCGTCGAAACCAAGGGCGAGCCGATTGAGACAAAGAGAGTAACGTGGTGCCATCGAATG
CGGACGACGCGGGACCATGCCGAGATTCCGGAGCTCATGGAGGTGCTGGGCTTGGACGGCCAGGGCGAGCCCATC
AAGGACGGCAAGCGCTGGTCCAAGGCCTTGAACACGCGCAAAGGCACCGGCTTTACCATGGCCAACCAGATGCGG
CGAATCAGCGAGACAAACATGGAGAATGCCGCCATTGCCAGCGCCGACGAGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail