Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7884
Gene name
LocationContig_97:12818..14371
Strand-
Gene length (bp)1553
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 8.9E-46 122 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YS77|MAP21_NECH7 Methionine aminopeptidase 2-1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_61369 PE=3 SV=1 1 438 0.0E+00
sp|E3QW41|MAP22_COLGM Methionine aminopeptidase 2-2 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10223 PE=3 SV=1 1 438 0.0E+00
sp|C9SB49|MAP2_VERA1 Methionine aminopeptidase 2 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01708 PE=3 SV=1 1 438 0.0E+00
sp|Q7S7L7|MAP2_NEUCR Methionine aminopeptidase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7H23.090 PE=3 SV=2 70 438 0.0E+00
sp|D1ZEN1|MAP2_SORMK Methionine aminopeptidase 2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_05580 PE=3 SV=1 70 438 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YS77|MAP21_NECH7 Methionine aminopeptidase 2-1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_61369 PE=3 SV=1 1 438 0.0E+00
sp|E3QW41|MAP22_COLGM Methionine aminopeptidase 2-2 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10223 PE=3 SV=1 1 438 0.0E+00
sp|C9SB49|MAP2_VERA1 Methionine aminopeptidase 2 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01708 PE=3 SV=1 1 438 0.0E+00
sp|Q7S7L7|MAP2_NEUCR Methionine aminopeptidase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7H23.090 PE=3 SV=2 70 438 0.0E+00
sp|D1ZEN1|MAP2_SORMK Methionine aminopeptidase 2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_05580 PE=3 SV=1 70 438 0.0E+00
sp|B2B738|MAP2_PODAN Methionine aminopeptidase 2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_9800 PE=3 SV=1 1 438 0.0E+00
sp|Q2GYA8|MAP22_CHAGB Methionine aminopeptidase 2-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07046 PE=3 SV=1 1 438 0.0E+00
sp|B8LUH2|MAP21_TALSN Methionine aminopeptidase 2-1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_071420 PE=3 SV=1 72 438 0.0E+00
sp|A1CXT5|MAP21_NEOFI Methionine aminopeptidase 2-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_109310 PE=3 SV=1 72 438 0.0E+00
sp|B6Q1N3|MAP21_TALMQ Methionine aminopeptidase 2-1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_027380 PE=3 SV=1 72 438 0.0E+00
sp|Q4WNT9|MAP23_ASPFU Methionine aminopeptidase 2-3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06930 PE=3 SV=2 71 438 0.0E+00
sp|B0Y5N4|MAP22_ASPFC Methionine aminopeptidase 2-2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_064000 PE=3 SV=2 71 438 0.0E+00
sp|A4RDI6|MAP2_MAGO7 Methionine aminopeptidase 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00966 PE=3 SV=1 1 438 0.0E+00
sp|Q0CL94|MAP22_ASPTN Methionine aminopeptidase 2-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_05540 PE=3 SV=1 71 438 0.0E+00
sp|C5JW60|MAP21_AJEDS Methionine aminopeptidase 2-1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_06837 PE=3 SV=1 1 438 0.0E+00
sp|C5GCN0|MAP21_AJEDR Methionine aminopeptidase 2-1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_02379 PE=3 SV=1 1 438 0.0E+00
sp|C0SIM8|MAP2_PARBP Methionine aminopeptidase 2 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_07533 PE=3 SV=1 72 438 0.0E+00
sp|C1HAB2|MAP2_PARBA Methionine aminopeptidase 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_07566 PE=3 SV=1 72 438 0.0E+00
sp|C1GLM4|MAP2_PARBD Methionine aminopeptidase 2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_08265 PE=3 SV=1 1 438 0.0E+00
sp|B8NA06|MAP21_ASPFN Methionine aminopeptidase 2-1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_113020 PE=3 SV=1 72 438 0.0E+00
sp|A2QHX0|MAP22_ASPNC Methionine aminopeptidase 2-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An04g01330 PE=3 SV=1 72 438 0.0E+00
sp|Q5B4X6|MAP21_EMENI Methionine aminopeptidase 2-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN4404 PE=3 SV=1 72 438 0.0E+00
sp|C4JSX6|MAP2_UNCRE Methionine aminopeptidase 2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_05565 PE=3 SV=1 72 438 0.0E+00
sp|C0NIQ4|MAP21_AJECG Methionine aminopeptidase 2-1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_02311 PE=3 SV=1 1 438 0.0E+00
sp|C5P8Q4|MAP2_COCP7 Methionine aminopeptidase 2 OS=Coccidioides posadasii (strain C735) GN=CPC735_002850 PE=3 SV=2 71 438 0.0E+00
sp|A7EZ86|MAP2_SCLS1 Methionine aminopeptidase 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10653 PE=3 SV=1 1 438 0.0E+00
sp|C5FF46|MAP22_ARTOC Methionine aminopeptidase 2-2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01318 PE=3 SV=1 1 438 0.0E+00
sp|D4B2G3|MAP2_ARTBC Methionine aminopeptidase 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02691 PE=3 SV=2 72 438 0.0E+00
sp|D4DE65|MAP2_TRIVH Methionine aminopeptidase 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05431 PE=3 SV=2 72 438 0.0E+00
sp|E5R3Z8|MAP22_ARTGP Methionine aminopeptidase 2-2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_01859 PE=3 SV=1 72 438 0.0E+00
sp|A6RTU0|MAP2_BOTFB Methionine aminopeptidase 2 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_04189 PE=3 SV=1 1 438 0.0E+00
sp|E5R4J3|MAP22_LEPMJ Methionine aminopeptidase 2-2 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P046670 PE=3 SV=1 1 438 0.0E+00
sp|B2W1N6|MAP22_PYRTR Methionine aminopeptidase 2-2 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04371 PE=3 SV=1 1 438 0.0E+00
sp|A1CH02|MAP22_ASPCL Methionine aminopeptidase 2-2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_046220 PE=3 SV=1 72 421 0.0E+00
sp|E3RCY7|MAP21_PYRTT Methionine aminopeptidase 2-1 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_01272 PE=3 SV=1 72 438 0.0E+00
sp|A1DA84|MAP23_NEOFI Methionine aminopeptidase 2-3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_093940 PE=3 SV=1 72 438 0.0E+00
sp|B6HTQ4|MAP22_PENRW Methionine aminopeptidase 2-2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc22g18010 PE=3 SV=1 72 423 0.0E+00
sp|B0YAX5|MAP23_ASPFC Methionine aminopeptidase 2-3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_086160 PE=3 SV=2 10 438 0.0E+00
sp|Q4WAY7|MAP21_ASPFU Methionine aminopeptidase 2-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_8G00410 PE=3 SV=2 10 438 0.0E+00
sp|Q0UTI9|MAP2_PHANO Methionine aminopeptidase 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04925 PE=3 SV=1 1 428 0.0E+00
sp|B6QD96|MAP22_TALMQ Methionine aminopeptidase 2-2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_077770 PE=3 SV=1 72 438 3.0E-176
sp|D8PR70|MAP2_SCHCM Methionine aminopeptidase 2 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_64644 PE=3 SV=1 20 438 5.0E-175
sp|B8M990|MAP22_TALSN Methionine aminopeptidase 2-2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_112180 PE=3 SV=1 72 438 2.0E-173
sp|O60085|MAP2_SCHPO Methionine aminopeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fma2 PE=3 SV=1 31 438 8.0E-173
sp|A1CYM1|MAP22_NEOFI Methionine aminopeptidase 2-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_034070 PE=3 SV=1 72 438 1.0E-165
sp|Q3ZC89|MAP2_BOVIN Methionine aminopeptidase 2 OS=Bos taurus GN=METAP2 PE=2 SV=1 67 438 3.0E-165
sp|P38062|MAP2_RAT Methionine aminopeptidase 2 OS=Rattus norvegicus GN=Metap2 PE=1 SV=2 67 438 1.0E-164
sp|O08663|MAP2_MOUSE Methionine aminopeptidase 2 OS=Mus musculus GN=Metap2 PE=1 SV=1 67 438 3.0E-164
sp|Q5BGG1|MAP22_EMENI Methionine aminopeptidase 2-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0369 PE=3 SV=2 72 438 3.0E-164
sp|Q4WII3|MAP22_ASPFU Methionine aminopeptidase 2-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G01750 PE=3 SV=1 72 438 4.0E-164
sp|B0XTJ7|MAP21_ASPFC Methionine aminopeptidase 2-1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_018820 PE=3 SV=1 72 438 4.0E-164
sp|P50579|MAP2_HUMAN Methionine aminopeptidase 2 OS=Homo sapiens GN=METAP2 PE=1 SV=1 67 438 6.0E-164
sp|E3L3Q8|MAP2_PUCGT Methionine aminopeptidase 2 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_16374 PE=3 SV=1 71 438 2.0E-163
sp|B0CRL4|MAP2_LACBS Methionine aminopeptidase 2 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_242662 PE=3 SV=1 95 438 4.0E-163
sp|E3RD74|MAP22_PYRTT Methionine aminopeptidase 2-2 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_01727 PE=3 SV=1 72 438 2.0E-162
sp|A1CCP2|MAP21_ASPCL Methionine aminopeptidase 2-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_062640 PE=3 SV=1 72 438 2.0E-161
sp|C4R2P3|MAP2_PICPG Methionine aminopeptidase 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MAP2 PE=3 SV=1 80 438 2.0E-161
sp|C6HI66|MAP2_AJECH Methionine aminopeptidase 2 OS=Ajellomyces capsulatus (strain H143) GN=HCDG_06216 PE=3 SV=1 72 438 7.0E-161
sp|C0NX86|MAP22_AJECG Methionine aminopeptidase 2-2 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_08078 PE=3 SV=1 72 438 8.0E-161
sp|A6RGC8|MAP2_AJECN Methionine aminopeptidase 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_08694 PE=3 SV=1 72 438 2.0E-160
sp|E4ZYY3|MAP21_LEPMJ Methionine aminopeptidase 2-1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P106830 PE=3 SV=1 72 438 3.0E-160
sp|C5FEJ1|MAP21_ARTOC Methionine aminopeptidase 2-1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01113 PE=3 SV=1 72 438 4.0E-160
sp|E5R278|MAP21_ARTGP Methionine aminopeptidase 2-1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_01664 PE=3 SV=1 72 438 5.0E-160
sp|A2QAF9|MAP21_ASPNC Methionine aminopeptidase 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g11360 PE=3 SV=1 69 438 7.0E-160
sp|Q56Y85|MAP22_ARATH Methionine aminopeptidase 2B OS=Arabidopsis thaliana GN=MAP2B PE=2 SV=2 72 438 3.0E-159
sp|B6H5L5|MAP21_PENRW Methionine aminopeptidase 2-1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc14g00010 PE=3 SV=1 50 438 4.0E-158
sp|B2VW14|MAP21_PYRTR Methionine aminopeptidase 2-1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_01376 PE=3 SV=1 72 438 7.0E-158
sp|Q6CA79|MAP2_YARLI Methionine aminopeptidase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MAP2 PE=3 SV=1 68 438 5.0E-156
sp|Q9FV49|MAP21_ARATH Methionine aminopeptidase 2A OS=Arabidopsis thaliana GN=MAP2A PE=2 SV=2 72 438 1.0E-155
sp|Q2U6H2|MAP2_ASPOR Methionine aminopeptidase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090120000238 PE=3 SV=1 72 438 2.0E-155
sp|B8NLL0|MAP22_ASPFN Methionine aminopeptidase 2-2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_092260 PE=3 SV=1 72 438 2.0E-155
sp|Q6BVB8|MAP2_DEBHA Methionine aminopeptidase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAP2 PE=3 SV=2 80 438 3.0E-155
sp|A8QBZ2|MAP2_MALGO Methionine aminopeptidase 2 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3955 PE=3 SV=1 72 438 3.0E-154
sp|C5JYZ5|MAP22_AJEDS Methionine aminopeptidase 2-2 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_07768 PE=3 SV=1 72 438 3.0E-153
sp|C5GLJ6|MAP22_AJEDR Methionine aminopeptidase 2-2 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_05228 PE=3 SV=1 72 438 2.0E-152
sp|Q6CP80|MAP2_KLULA Methionine aminopeptidase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MAP2 PE=3 SV=1 80 438 2.0E-152
sp|C7Z7V7|MAP22_NECH7 Methionine aminopeptidase 2-2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_93045 PE=3 SV=1 70 438 1.0E-151
sp|Q0C838|MAP21_ASPTN Methionine aminopeptidase 2-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_10146 PE=3 SV=1 70 438 4.0E-150
sp|C4Y1F8|MAP2_CLAL4 Methionine aminopeptidase 2 OS=Clavispora lusitaniae (strain ATCC 42720) GN=MAP2 PE=3 SV=1 78 438 2.0E-149
sp|C4YSA9|MAP2_CANAW Methionine aminopeptidase 2 OS=Candida albicans (strain WO-1) GN=MAP2 PE=3 SV=1 78 438 6.0E-149
sp|Q59LF9|MAP2_CANAL Methionine aminopeptidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAP2 PE=3 SV=1 78 438 7.0E-149
sp|C5DE35|MAP2_LACTC Methionine aminopeptidase 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MAP2 PE=3 SV=1 80 438 7.0E-149
sp|A5E5I9|MAP2_LODEL Methionine aminopeptidase 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MAP2 PE=3 SV=1 78 438 8.0E-149
sp|Q2GSJ7|MAP21_CHAGB Methionine aminopeptidase 2-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_09057 PE=3 SV=1 68 438 1.0E-148
sp|A5DR89|MAP2_PICGU Methionine aminopeptidase 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAP2 PE=3 SV=2 84 438 2.0E-148
sp|P38174|MAP2_YEAST Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAP2 PE=1 SV=4 80 438 2.0E-146
sp|C8Z3V4|MAP2_YEAS8 Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MAP2 PE=3 SV=1 80 438 2.0E-146
sp|A6ZKL2|MAP2_YEAS7 Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=MAP2 PE=3 SV=1 80 438 2.0E-146
sp|B5VDQ0|MAP2_YEAS6 Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MAP2 PE=3 SV=1 80 438 2.0E-146
sp|C7GSF3|MAP2_YEAS2 Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=MAP2 PE=3 SV=1 80 438 2.0E-146
sp|B3LNM2|MAP2_YEAS1 Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MAP2 PE=3 SV=1 80 438 2.0E-146
sp|B9WJA2|MAP2_CANDC Methionine aminopeptidase 2 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MAP2 PE=3 SV=1 78 438 3.0E-146
sp|E3QDQ4|MAP21_COLGM Methionine aminopeptidase 2-1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_04136 PE=3 SV=1 72 438 1.0E-145
sp|C5M8M4|MAP2_CANTT Methionine aminopeptidase 2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MAP2 PE=3 SV=1 78 438 3.0E-145
sp|Q55C21|MAP2_DICDI Methionine aminopeptidase 2 OS=Dictyostelium discoideum GN=metap2 PE=3 SV=3 71 438 2.0E-144
sp|Q6XMH7|MAP2_ENCIT Methionine aminopeptidase 2 OS=Encephalitozoon intestinalis (strain ATCC 50506) GN=MAP2 PE=3 SV=2 90 438 2.0E-77
sp|Q6XMH6|MAP2_ENCHA Methionine aminopeptidase 2 OS=Encephalitozoon hellem (strain ATCC 50504) GN=MAP2 PE=3 SV=1 117 438 2.0E-76
sp|Q8SR45|MAP2_ENCCU Methionine aminopeptidase 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=MAP2 PE=1 SV=1 112 438 8.0E-73
sp|Q58725|MAP2_METJA Methionine aminopeptidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=map PE=3 SV=1 125 434 1.0E-50
sp|P56218|MAP2_PYRFU Methionine aminopeptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=map PE=1 SV=1 125 424 1.0E-50
sp|O58362|MAP2_PYRHO Methionine aminopeptidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=map PE=3 SV=1 125 424 3.0E-49
sp|Q5JGD1|MAP2_THEKO Methionine aminopeptidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=map PE=3 SV=1 125 424 8.0E-47
sp|B6YTG0|MAP2_THEON Methionine aminopeptidase OS=Thermococcus onnurineus (strain NA1) GN=map PE=1 SV=1 125 424 2.0E-46
sp|Q9UYT4|MAP2_PYRAB Methionine aminopeptidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=map PE=3 SV=1 125 424 1.0E-45
sp|O27355|MAP2_METTH Methionine aminopeptidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=map PE=3 SV=1 119 424 4.0E-37
sp|P50581|YD43_CAEEL Putative uncharacterized protein T27A8.3 OS=Caenorhabditis elegans GN=T27A8.3 PE=5 SV=1 272 404 1.0E-34
sp|P95963|MAP2_SULSO Methionine aminopeptidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=map PE=3 SV=1 174 425 1.0E-33
sp|O28438|MAP2_ARCFU Methionine aminopeptidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=map PE=3 SV=1 125 424 1.0E-33
sp|Q96327|EBP1_ARATH ERBB-3 BINDING PROTEIN 1 OS=Arabidopsis thaliana GN=EBP1 PE=2 SV=1 108 426 7.0E-28
sp|M1CZC0|EBP1_SOLTU ERBB-3 BINDING PROTEIN 1 OS=Solanum tuberosum GN=EBP1 PE=2 SV=1 108 426 5.0E-26
sp|Q1ZXG4|PRLA_DICDI Proliferation-associated protein A OS=Dictyostelium discoideum GN=prlA PE=2 SV=1 112 426 2.0E-24
sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens GN=PA2G4 PE=1 SV=3 173 426 3.0E-20
sp|Q6AYD3|PA2G4_RAT Proliferation-associated protein 2G4 OS=Rattus norvegicus GN=Pa2g4 PE=1 SV=1 173 426 7.0E-20
sp|P50580|PA2G4_MOUSE Proliferation-associated protein 2G4 OS=Mus musculus GN=Pa2g4 PE=1 SV=3 173 426 1.0E-19
sp|P22624|MAP2_METFE Methionine aminopeptidase (Fragment) OS=Methanothermus fervidus GN=map PE=3 SV=1 120 315 1.0E-18
sp|Q09184|CDB4_SCHPO Curved DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdb4 PE=1 SV=1 114 424 1.0E-11
sp|Q9ZJT0|MAP1_HELPJ Methionine aminopeptidase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=map PE=3 SV=1 124 324 6.0E-10
sp|P53581|MAP13_SYNY3 Methionine aminopeptidase C OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0555 PE=3 SV=1 120 335 1.0E-07
sp|Q9FV52|MAP1B_ARATH Methionine aminopeptidase 1B, chloroplastic OS=Arabidopsis thaliana GN=MAP1B PE=2 SV=2 60 329 4.0E-07
sp|Q9FV50|MAP1D_ARATH Methionine aminopeptidase 1D, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1D PE=1 SV=1 54 337 8.0E-07
sp|O66489|MAP1_AQUAE Methionine aminopeptidase OS=Aquifex aeolicus (strain VF5) GN=map PE=3 SV=1 112 331 1.0E-06
sp|P50614|MAP1_CLOPE Methionine aminopeptidase OS=Clostridium perfringens (strain 13 / Type A) GN=map PE=3 SV=2 124 335 2.0E-06
sp|Q59509|MAP1_MYCCT Methionine aminopeptidase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=map PE=3 SV=2 138 368 3.0E-06
sp|Q9Z9J4|MAP1_BACHD Methionine aminopeptidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=map PE=3 SV=1 124 335 4.0E-06
sp|P19994|MAP11_BACSU Methionine aminopeptidase 1 OS=Bacillus subtilis (strain 168) GN=map PE=1 SV=1 120 335 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7884
MAAQIPTDALKELAVTDAAAKPNGQGSKPAVPEDDDAHGDVSDDDAQDHTAPTDKKKKKRKPRKKKKAPTAQSEP
PRVKVSQLFPNQTYPKGQEVEYNDNLARTTNEEKRHIESFSNDFLADYREAAEIHRQVRQYAQKTIRPGQTLTEI
AETIEDGVRALTGHDGLAEGDALKAGMGFPCGLSLNHCAAHYTPNAGNKMVLQQQDVMKVDFGVHVNGRIVDSAF
TMAFEPKYDNLLQAVKDATNAGIREAGVDARVGEIGGVIQETMESYEVEIDGTSYPVKSIRNLTGHTILPYSIHG
TKTVPIVKSNDQTKMEEGDVFAIETFGSTGNGYVRDDMEVSHYAKNEDVQHVDLRLSSAKSLLNVINKNFGTLPF
CRRYLDRIGQEKYLLGLNSLVTNGIVEAYPPLCDKKGSYTAQFEHTILIRPTVKEVISRGEDY*
Coding >OphauG2|7884
ATGGCGGCTCAGATTCCCACGGATGCTCTCAAGGAGCTTGCAGTGACTGACGCCGCTGCAAAGCCAAACGGCCAG
GGCTCCAAACCAGCCGTGCCCGAAGACGACGACGCTCACGGCGACGTCTCGGACGACGATGCTCAAGACCATACC
GCCCCAACTGACAAGAAAAAGAAGAAGCGAAAGCCCAGGAAGAAGAAGAAGGCCCCCACGGCGCAGTCGGAGCCG
CCTCGCGTCAAGGTCAGCCAACTCTTCCCCAACCAGACCTATCCCAAGGGCCAAGAGGTCGAGTACAACGACAAT
CTTGCGCGAACAACAAACGAGGAGAAGCGCCACATTGAGAGCTTCAGCAACGACTTTTTGGCCGACTACCGTGAG
GCGGCCGAGATTCACCGCCAAGTGCGGCAGTATGCTCAAAAGACGATTCGCCCGGGCCAGACCCTGACTGAGATT
GCCGAGACGATTGAGGACGGTGTCCGCGCGCTTACCGGCCATGATGGGCTGGCCGAGGGCGATGCCCTCAAGGCA
GGCATGGGCTTCCCCTGCGGCCTGAGCCTCAACCATTGCGCTGCTCACTATACCCCCAATGCCGGCAACAAGATG
GTGCTGCAGCAACAAGACGTCATGAAGGTTGATTTTGGCGTCCACGTCAATGGCCGCATCGTCGACTCGGCCTTT
ACCATGGCCTTTGAGCCCAAATACGACAACCTGCTTCAAGCAGTCAAGGACGCCACCAATGCAGGCATCCGCGAG
GCGGGCGTCGATGCGCGAGTAGGCGAGATTGGTGGAGTCATTCAAGAGACAATGGAGAGCTACGAGGTTGAGATT
GACGGCACCAGCTATCCCGTCAAGAGCATCCGCAACCTTACAGGCCACACGATTTTGCCCTACAGCATCCACGGC
ACCAAGACGGTGCCCATTGTCAAGAGCAACGACCAGACCAAGATGGAGGAGGGCGACGTGTTTGCCATTGAGACA
TTTGGCAGCACAGGAAACGGCTATGTGCGCGACGACATGGAGGTGTCGCACTATGCAAAGAATGAAGACGTACAG
CACGTTGATTTGCGGCTGAGTTCGGCAAAGTCGTTGCTCAATGTCATCAACAAGAACTTTGGGACGCTTCCCTTT
TGCCGGCGATATTTGGATCGCATCGGCCAGGAAAAATACCTGCTGGGCCTGAATAGCTTGGTCACCAATGGCATT
GTCGAGGCATATCCGCCACTGTGTGACAAGAAGGGCTCATACACGGCCCAGTTTGAACATACCATTTTGATACGG
CCAACGGTCAAGGAGGTGATTAGCCGTGGCGAGGATTACTAG
Transcript >OphauG2|7884
ATGGCGGCTCAGATTCCCACGGATGCTCTCAAGGAGCTTGCAGTGACTGACGCCGCTGCAAAGCCAAACGGCCAG
GGCTCCAAACCAGCCGTGCCCGAAGACGACGACGCTCACGGCGACGTCTCGGACGACGATGCTCAAGACCATACC
GCCCCAACTGACAAGAAAAAGAAGAAGCGAAAGCCCAGGAAGAAGAAGAAGGCCCCCACGGCGCAGTCGGAGCCG
CCTCGCGTCAAGGTCAGCCAACTCTTCCCCAACCAGACCTATCCCAAGGGCCAAGAGGTCGAGTACAACGACAAT
CTTGCGCGAACAACAAACGAGGAGAAGCGCCACATTGAGAGCTTCAGCAACGACTTTTTGGCCGACTACCGTGAG
GCGGCCGAGATTCACCGCCAAGTGCGGCAGTATGCTCAAAAGACGATTCGCCCGGGCCAGACCCTGACTGAGATT
GCCGAGACGATTGAGGACGGTGTCCGCGCGCTTACCGGCCATGATGGGCTGGCCGAGGGCGATGCCCTCAAGGCA
GGCATGGGCTTCCCCTGCGGCCTGAGCCTCAACCATTGCGCTGCTCACTATACCCCCAATGCCGGCAACAAGATG
GTGCTGCAGCAACAAGACGTCATGAAGGTTGATTTTGGCGTCCACGTCAATGGCCGCATCGTCGACTCGGCCTTT
ACCATGGCCTTTGAGCCCAAATACGACAACCTGCTTCAAGCAGTCAAGGACGCCACCAATGCAGGCATCCGCGAG
GCGGGCGTCGATGCGCGAGTAGGCGAGATTGGTGGAGTCATTCAAGAGACAATGGAGAGCTACGAGGTTGAGATT
GACGGCACCAGCTATCCCGTCAAGAGCATCCGCAACCTTACAGGCCACACGATTTTGCCCTACAGCATCCACGGC
ACCAAGACGGTGCCCATTGTCAAGAGCAACGACCAGACCAAGATGGAGGAGGGCGACGTGTTTGCCATTGAGACA
TTTGGCAGCACAGGAAACGGCTATGTGCGCGACGACATGGAGGTGTCGCACTATGCAAAGAATGAAGACGTACAG
CACGTTGATTTGCGGCTGAGTTCGGCAAAGTCGTTGCTCAATGTCATCAACAAGAACTTTGGGACGCTTCCCTTT
TGCCGGCGATATTTGGATCGCATCGGCCAGGAAAAATACCTGCTGGGCCTGAATAGCTTGGTCACCAATGGCATT
GTCGAGGCATATCCGCCACTGTGTGACAAGAAGGGCTCATACACGGCCCAGTTTGAACATACCATTTTGATACGG
CCAACGGTCAAGGAGGTGATTAGCCGTGGCGAGGATTACTAG
Gene >OphauG2|7884
ATGGCGGCTCAGATTCCCACGGATGCTCTCAAGGAGCTTGCAGGTAAGCAGTCGGAGCTCTCTCTATTCGTACAC
GTCTCGAGTGGCTGCTCAGGCGCAAACACCGCGACTAACATTTTAATTTAGTGACTGACGCCGCTGCAAAGCCAA
ACGGCCAGGGCTCCAAACCAGCCGTGCCCGAAGACGACGACGCTCACGGCGACGTCTCGGACGACGATGCTCAAG
ACCATACCGCCCCAACTGACAAGAAAAAGAAGAAGCGAAAGCCCAGGAAGAAGAAGAAGGCCCCCACGGCGCAGT
CGGAGCCGCCTCGCGTCAAGGTCAGCCAACTCTTCCCCAACCAGACCTATCCCAAGGGCCAAGAGGTCGAGTACA
ACGACAATCTTGCGCGAACAACAAACGAGGAGAAGCGCCACATTGAGAGCTTCAGCAACGACTTTTTGGCCGACT
ACCGTGAGGCGGCCGAGATTCACCGCCAAGTGCGGCAGTATGCTCAAAAGACGATTCGCCCGGGCCAGACCCTGA
CTGAGATTGCCGAGACGATTGAGGACGGTGTCCGCGCGCTTACCGGCCATGATGGGCTGGCCGAGGGCGATGCCC
TCAAGGCAGGCATGGGCTTCCCCTGCGGCCTGAGCCTCAACCATTGCGCTGCTCACTATACCCCCAATGCCGGCA
ACAAGATGGTGCTGCAGCAACAAGACGTCATGAAGGTTGATTTTGGCGTCCACGTCAATGGCCGCATCGTCGACT
CGGCCTTTACCATGGCCTTTGAGCCCAAATACGACAACCTGCTTCAAGCAGTCAAGGACGCCACCAATGCAGGCA
TCCGCGAGGCGGGCGTCGATGCGCGAGTAGGCGAGATTGGTGGAGTCATTCAAGAGACAATGGAGAGCTACGAGG
TTGAGATTGACGGCACCAGCTATCCCGTCAAGAGCATCCGCAACCTTACAGGCCACACGATTTTGCCCTACAGCA
TCCACGGCACCAAGACGGTGCCCATTGTCAAGAGCAACGACCAGACCAAGATGGAGGAGGGCGACGTGTTTGCCA
TTGAGACATTTGGCAGCACAGGAAACGGCTATGTGCGCGACGACATGGAGGTGTCGCACTATGCAAAGAATGAAG
ACGTACAGCACGTTGATTTGCGGCTGAGTTCGGCAAAGTCGTTGCTCAATGTCATCAACAAGAACTTTGGGACGC
TTCCCTTTTGCCGGCGATATTTGGATCGCATCGGCCAGGAAAAATACCTGCTGGGCGTGAGTTGGCCATGATGCT
TGTGTTTAAAAAAAAGAGGAAAAGAAACAAAAAGAAAAGAGAGAAAAGGGTTACTGACGCAAAGCAGCTGAATAG
CTTGGTCACCAATGGCATTGTCGAGGCATATCCGCCACTGTGTGACAAGAAGGGCTCATACACGGCCCAGTTTGA
ACATGTGAGTCGAATATATACTATATTAGGGCACTGTCGCACACAACTTGGCCCAGACTAATGCGAGACAGACCA
TTTTGATACGGCCAACGGTCAAGGAGGTGATTAGCCGTGGCGAGGATTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail