Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7866
Gene name
LocationContig_966:1634..2753
Strand-
Gene length (bp)1119
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00775 Dioxygenase_C Dioxygenase 1.8E-39 112 293
PF04444 Dioxygenase_N Catechol dioxygenase N terminus 5.9E-28 33 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6F4M7|NPCC_RHOOP Hydroxyquinol 1,2-dioxygenase OS=Rhodococcus opacus GN=npcC PE=2 SV=1 20 267 1.0E-62
sp|Q5PXQ6|CHQB_NOCSI Hydroxyquinol 1,2-dioxygenase OS=Nocardioides simplex GN=chqB PE=1 SV=1 19 269 8.0E-54
sp|P86029|HQD2_CANAL Catechol 1,2-dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HQD2 PE=1 SV=1 35 303 4.0E-49
sp|P07773|CATA_ACIAD Catechol 1,2-dioxygenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catA PE=1 SV=1 26 266 3.0E-25
sp|P31019|PHEB_PSEUE Catechol 1,2-dioxygenase OS=Pseudomonas sp. (strain EST1001) GN=pheB PE=3 SV=1 24 303 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6F4M7|NPCC_RHOOP Hydroxyquinol 1,2-dioxygenase OS=Rhodococcus opacus GN=npcC PE=2 SV=1 20 267 1.0E-62
sp|Q5PXQ6|CHQB_NOCSI Hydroxyquinol 1,2-dioxygenase OS=Nocardioides simplex GN=chqB PE=1 SV=1 19 269 8.0E-54
sp|P86029|HQD2_CANAL Catechol 1,2-dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HQD2 PE=1 SV=1 35 303 4.0E-49
sp|P07773|CATA_ACIAD Catechol 1,2-dioxygenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catA PE=1 SV=1 26 266 3.0E-25
sp|P31019|PHEB_PSEUE Catechol 1,2-dioxygenase OS=Pseudomonas sp. (strain EST1001) GN=pheB PE=3 SV=1 24 303 3.0E-25
sp|O67987|CLCA_RHOOP Chlorocatechol 1,2-dioxygenase OS=Rhodococcus opacus GN=clcA PE=1 SV=1 32 290 2.0E-24
sp|P11451|CLCA_PSEPU Chlorocatechol 1,2-dioxygenase OS=Pseudomonas putida GN=clcA PE=1 SV=1 33 311 4.0E-24
sp|P27098|TCBC_PSESQ Chlorocatechol 1,2-dioxygenase OS=Pseudomonas sp. (strain P51) GN=tcbC PE=3 SV=1 35 298 5.0E-24
sp|Q43984|CATA_ACIGI Catechol 1,2-dioxygenase OS=Acinetobacter guillouiae GN=catA PE=2 SV=1 35 294 6.0E-24
sp|P0A396|TFDC_CUPPJ Chlorocatechol 1,2-dioxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdC PE=3 SV=1 33 293 3.0E-21
sp|P0A397|TFDC_BURCE Chlorocatechol 1,2-dioxygenase OS=Burkholderia cepacia GN=tfdC PE=3 SV=1 33 293 3.0E-21
sp|O33950|CATA2_ACILW Catechol 1,2-dioxygenase 2 OS=Acinetobacter lwoffii GN=catA2 PE=1 SV=1 32 264 3.0E-20
sp|P95607|CATA_RHOOP Catechol 1,2-dioxygenase (Fragment) OS=Rhodococcus opacus GN=catA PE=1 SV=1 106 293 3.0E-20
sp|O33948|CATA1_ACILW Catechol 1,2-dioxygenase 1 OS=Acinetobacter lwoffii GN=catA1 PE=1 SV=3 26 264 4.0E-18
sp|P15110|PCXB_BURCE Protocatechuate 3,4-dioxygenase beta chain OS=Burkholderia cepacia GN=pcaH PE=3 SV=1 134 257 4.0E-10
sp|P00437|PCXB_PSEPU Protocatechuate 3,4-dioxygenase beta chain OS=Pseudomonas putida GN=pcaH PE=1 SV=3 135 299 9.0E-09
sp|P20372|PCXB_ACIAD Protocatechuate 3,4-dioxygenase beta chain OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaH PE=1 SV=2 135 256 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0018576 catechol 1,2-dioxygenase activity Yes
GO:0005506 iron ion binding Yes
GO:0008199 ferric iron binding Yes
GO:0009712 catechol-containing compound metabolic process Yes
GO:0006725 cellular aromatic compound metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0043167 ion binding No
GO:0051213 dioxygenase activity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0046872 metal ion binding No
GO:0018958 phenol-containing compound metabolic process No
GO:0019114 catechol dioxygenase activity No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:1901615 organic hydroxy compound metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7866
MAPQAADGAPSLVDLTTDNITSNVLSINSQSGDARLTYLMERLVTHLHDFARETRLSTNEWLAGLQFLVGCGKIS
SETRQEFILLSDVLGLSLLVDSINHPKPPLSTQGTVLGPFHTHDAPDMASGDSISTDINGEPLLVLCRVRDAAGS
PISHVRIDIWETDSSGHYDVQHANREAPSERCVMHSDAQGNFWFKAIKPVSYPIPTDGPVGQLLHMLKRQSSRPA
HMHFMFEKSGWDQLTTALYMRGDKFETSDPVFGVKSSLIVDLDKVDKATAAEYGVKEGSLLLKHDFVLVSQKETE
ELRDQNATEALKILGLKLKLVDHLPVPDVD*
Coding >OphauG2|7866
ATGGCGCCACAAGCAGCAGACGGGGCTCCGTCGCTCGTGGACCTGACAACCGACAACATCACGAGCAATGTGTTG
AGCATCAACTCGCAGAGCGGCGATGCTCGGCTGACGTACCTCATGGAGCGTCTCGTTACGCATCTGCACGACTTT
GCGCGGGAAACACGCCTGAGCACAAACGAGTGGCTCGCTGGGCTACAGTTCCTAGTGGGCTGCGGCAAGATAAGT
AGTGAGACTCGCCAGGAATTCATTCTCCTGTCCGACGTGCTCGGGCTGTCGCTACTGGTGGATTCTATAAACCAT
CCCAAGCCACCCTTATCCACCCAAGGCACCGTGCTAGGCCCCTTCCATACACACGATGCCCCAGATATGGCGTCG
GGAGACAGCATATCAACAGACATCAACGGTGAGCCACTGCTGGTATTGTGCAGGGTGCGCGATGCAGCCGGCAGC
CCCATCTCACATGTCAGAATCGACATATGGGAAACAGACTCGTCGGGCCACTATGACGTCCAGCACGCCAATCGC
GAGGCGCCCAGCGAGCGCTGCGTCATGCACAGCGATGCCCAGGGCAACTTCTGGTTCAAGGCCATCAAGCCTGTC
AGCTACCCAATCCCAACCGACGGACCGGTTGGGCAACTACTGCACATGCTCAAGCGCCAGAGCAGTCGTCCGGCA
CACATGCACTTCATGTTTGAAAAGAGCGGATGGGACCAGCTCACCACGGCCTTGTACATGCGAGGAGACAAGTTT
GAAACGTCGGATCCCGTCTTCGGTGTCAAGAGCAGCCTTATCGTCGACCTCGACAAGGTGGACAAGGCAACAGCA
GCCGAGTATGGCGTCAAAGAGGGCAGCCTGTTGCTCAAACACGACTTTGTCTTGGTGTCGCAAAAGGAGACGGAG
GAGCTGCGCGACCAAAACGCTACCGAGGCCTTGAAGATACTAGGGCTCAAGCTCAAGCTGGTTGACCACTTGCCA
GTGCCCGATGTAGACTAA
Transcript >OphauG2|7866
ATGGCGCCACAAGCAGCAGACGGGGCTCCGTCGCTCGTGGACCTGACAACCGACAACATCACGAGCAATGTGTTG
AGCATCAACTCGCAGAGCGGCGATGCTCGGCTGACGTACCTCATGGAGCGTCTCGTTACGCATCTGCACGACTTT
GCGCGGGAAACACGCCTGAGCACAAACGAGTGGCTCGCTGGGCTACAGTTCCTAGTGGGCTGCGGCAAGATAAGT
AGTGAGACTCGCCAGGAATTCATTCTCCTGTCCGACGTGCTCGGGCTGTCGCTACTGGTGGATTCTATAAACCAT
CCCAAGCCACCCTTATCCACCCAAGGCACCGTGCTAGGCCCCTTCCATACACACGATGCCCCAGATATGGCGTCG
GGAGACAGCATATCAACAGACATCAACGGTGAGCCACTGCTGGTATTGTGCAGGGTGCGCGATGCAGCCGGCAGC
CCCATCTCACATGTCAGAATCGACATATGGGAAACAGACTCGTCGGGCCACTATGACGTCCAGCACGCCAATCGC
GAGGCGCCCAGCGAGCGCTGCGTCATGCACAGCGATGCCCAGGGCAACTTCTGGTTCAAGGCCATCAAGCCTGTC
AGCTACCCAATCCCAACCGACGGACCGGTTGGGCAACTACTGCACATGCTCAAGCGCCAGAGCAGTCGTCCGGCA
CACATGCACTTCATGTTTGAAAAGAGCGGATGGGACCAGCTCACCACGGCCTTGTACATGCGAGGAGACAAGTTT
GAAACGTCGGATCCCGTCTTCGGTGTCAAGAGCAGCCTTATCGTCGACCTCGACAAGGTGGACAAGGCAACAGCA
GCCGAGTATGGCGTCAAAGAGGGCAGCCTGTTGCTCAAACACGACTTTGTCTTGGTGTCGCAAAAGGAGACGGAG
GAGCTGCGCGACCAAAACGCTACCGAGGCCTTGAAGATACTAGGGCTCAAGCTCAAGCTGGTTGACCACTTGCCA
GTGCCCGATGTAGACTAA
Gene >OphauG2|7866
ATGGCGCCACAAGCAGCAGACGGGGCTCCGTCGCTCGTGGACCTGACAACCGACAACATCACGAGCAATGTGTTG
AGCATCAACTCGCAGAGCGGCGATGCTCGGCTGACGTACCTCATGGAGCGTCTCGTTACGCATCTGCACGACTTT
GCGCGGGAAACACGCCTGAGCACAAACGAGTGGCTCGCTGGGCTACAGTTCCTAGTGGGCTGCGGCAAGATAAGT
AGTGAGACTCGCCAGGTAAGCCAACACGACAAGTCGCCTCGCAAAATGCTCCTTTGGCAGGATCCAGCTGATAGA
GTCAATCTGGAGGAATTCATTCTCCTGTCCGACGTGCTCGGGCTGTCGCTACTGGTGGATTCTATAAACCATCCC
AAGCCACCCTTATCCACCCAAGGCACCGTGCTAGGCCCCTTCCATACACACGATGCCCCAGATATGGCGTCGGGA
GACAGCATATCAACAGACATCAACGGTGAGCCACTGCTGGTATTGTGCAGGGTGCGCGATGCAGCCGGCAGCCCC
ATCTCACATGTCAGAATCGACATATGGGAAACAGACTCGTCGGGCCACTATGACGTCCAGCACGCCAATCGCGAG
GCGCCCAGCGAGCGCTGCGTCATGCACAGCGATGCCCAGGGCAACTTCTGGTTCAAGGCCATCAAGCCTGTCAGC
TACCCAATCCCAACCGACGGACCGGTTGGGCAACTACTGCACATGCTCAAGCGCCAGAGCAGTCGTCCGGCACAC
ATGCACTTCATGTTTGAAAAGAGCGGATGGGACCAGCTCACCACGTGCGTATCACCGGCAGTGAACAAGGGGGGC
TGACAGCTGAAACTTGTTGCCAGGGCCTTGTACATGCGAGGAGACAAGTTTGAAACGTCGGATCCCGTCTTCGGT
GTCAAGAGCAGCCTTATCGTCGACCTCGACAAGGTGGACAAGGCAACAGCAGCCGAGTATGGCGTCAAAGAGGGC
AGCCTGTTGCTCAAACACGACTTTGTCTTGGTGTCGCAAAAGGAGACGGAGGAGCTGCGCGACCAAAACGCTACC
GAGGCCTTGAAGATACTAGGGCTCAAGCTCAAGCTGGTTGACCACTTGCCAGTGCCCGATGTAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail