Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7864
Gene name
LocationContig_965:5364..6780
Strand-
Gene length (bp)1416
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18055 RPN6_N 26S proteasome regulatory subunit RPN6 N-terminal domain 9.6E-41 12 129
PF01399 PCI PCI domain 1.9E-17 286 387
PF18503 RPN6_C_helix 26S proteasome subunit RPN6 C-terminal helix domain 6.9E-10 393 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S2|RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn6 PE=3 SV=1 13 422 5.0E-151
sp|F1LMZ8|PSD11_RAT 26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus GN=Psmd11 PE=1 SV=2 1 422 5.0E-141
sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3 1 422 5.0E-141
sp|Q2KI42|PSD11_BOVIN 26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3 1 422 5.0E-141
sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3 1 417 6.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S2|RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn6 PE=3 SV=1 13 422 5.0E-151
sp|F1LMZ8|PSD11_RAT 26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus GN=Psmd11 PE=1 SV=2 1 422 5.0E-141
sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3 1 422 5.0E-141
sp|Q2KI42|PSD11_BOVIN 26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3 1 422 5.0E-141
sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3 1 417 6.0E-141
sp|F6XBL2|PSD11_XENTR 26S proteasome non-ATPase regulatory subunit 11 OS=Xenopus tropicalis GN=psmd11 PE=3 SV=2 1 422 6.0E-141
sp|F6P3G4|PS11A_DANRE 26S proteasome non-ATPase regulatory subunit 11A OS=Danio rerio GN=psmd11a PE=2 SV=1 3 422 8.0E-137
sp|F1QGH9|PS11B_DANRE 26S proteasome non-ATPase regulatory subunit 11B OS=Danio rerio GN=psmd11b PE=2 SV=1 1 422 2.0E-136
sp|Q7KLV9|PSD11_DROME 26S proteasome non-ATPase regulatory subunit 11 OS=Drosophila melanogaster GN=Rpn6 PE=1 SV=1 47 415 2.0E-135
sp|Q12377|RPN6_YEAST 26S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN6 PE=1 SV=3 6 422 9.0E-114
sp|Q54UB5|PSD11_DICDI 26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum GN=psmD11 PE=2 SV=1 47 420 2.0E-112
sp|Q9LP45|PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 homolog OS=Arabidopsis thaliana GN=RPN6 PE=1 SV=1 37 422 3.0E-112
sp|Q20938|PS11A_CAEEL Probable 26S proteasome regulatory subunit rpn-6.1 OS=Caenorhabditis elegans GN=rpn-6.1 PE=2 SV=2 33 421 2.0E-111
sp|A8X379|PS11B_CAEBR Probable 26S proteasome regulatory subunit rpn-6.2 OS=Caenorhabditis briggsae GN=rpn-6.2 PE=3 SV=1 38 416 2.0E-78
sp|P34481|PS11B_CAEEL Probable 26S proteasome regulatory subunit rpn-6.2 OS=Caenorhabditis elegans GN=rpn-6.2 PE=3 SV=3 31 416 1.0E-75
sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 93 419 4.0E-19
sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=1 SV=1 93 419 2.0E-18
sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 93 419 2.0E-18
sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 93 419 2.0E-18
sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 165 419 5.0E-18
sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 165 380 2.0E-14
sp|Q54HL6|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1 118 380 4.0E-12
sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 114 380 7.0E-10
sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 131 387 1.0E-08
sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 165 385 1.0E-08
sp|Q7SI58|CSN2_NEUCR COP9 signalosome complex subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-2 PE=1 SV=1 108 385 1.0E-07
sp|Q9HFR0|CSN2_SCHPO COP9 signalosome complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn2 PE=1 SV=1 214 379 8.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2882
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7864 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3247
Ophiocordyceps camponoti-floridani Ophcf2|06648
Ophiocordyceps camponoti-rufipedis Ophun1|1168
Ophiocordyceps kimflemingae Ophio5|5296
Ophiocordyceps subramaniannii Hirsu2|4785

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7864
MAAGESSRLQEAQAVLKSDPKKAESIYRGIVSKTPLAASDAATREYESALISLGELYRDQANIQDLVSLVRDSRS
VFSSFAKAKSSKLVRQLLDLLREIPNSTNVEITLTKDCIEWATAERRAFQRQDLEVRLVTLYMNKQAYHDALALI
TGLLRELKRLDDKLRLVEVQLLESRVYHALGNIAKARAALTSARTSAASVYTPPLLQANLDMQSGMLHAEDKDFN
TAFSYFIEALDGYHSLDESTKAQAALQYMLLCKIMLNLVHDVNQLMASKQAVKYAGKSLEAMKAIARAHANRSLD
EYERALSLYRFELGSDAFVRNHLRRLYDAMLEQNLIKVIEPFSRVQIDHIAKMVALDTLQVERKLSQMILDKVII
GVLDQGAGCLIIYDETQRDESYDAALATIDKLSNVVDVLYTNQASMLE*
Coding >OphauG2|7864
ATGGCAGCCGGCGAGTCGAGCCGGCTTCAAGAAGCCCAAGCCGTGCTGAAATCAGACCCCAAAAAGGCAGAGTCG
ATTTATCGCGGCATCGTCTCCAAGACGCCTCTTGCCGCCTCGGATGCCGCCACTCGCGAGTACGAGAGTGCTCTG
ATAAGCTTGGGCGAGCTGTACAGAGATCAAGCAAATATTCAAGACCTCGTCAGCCTGGTACGCGATAGTCGCTCC
GTCTTTTCGTCCTTTGCAAAGGCCAAGTCGTCAAAGCTGGTCCGGCAGCTGCTCGACCTCCTCCGCGAGATCCCC
AACAGCACCAATGTCGAAATCACCCTGACCAAGGACTGCATCGAGTGGGCCACCGCCGAGCGCCGCGCCTTTCAG
CGCCAGGACCTCGAGGTCCGTCTCGTCACGCTCTACATGAACAAGCAAGCCTACCACGACGCCCTCGCCCTCATC
ACCGGCCTGCTCCGTGAGCTCAAGCGCCTCGATGACAAGCTCCGCCTGGTCGAAGTCCAGCTCCTCGAGTCGCGA
GTCTACCACGCCCTCGGCAACATTGCCAAGGCCCGCGCCGCCCTCACCTCGGCCCGCACCAGCGCCGCCAGTGTC
TACACTCCTCCCCTCCTCCAAGCAAACCTTGACATGCAGAGCGGCATGCTGCACGCTGAAGACAAGGACTTCAAC
ACGGCTTTTTCATACTTTATCGAGGCCCTCGACGGCTACCACAGCTTAGACGAGAGCACCAAGGCCCAGGCCGCT
CTGCAGTACATGCTGCTCTGCAAAATCATGCTCAACCTCGTCCACGACGTGAACCAGCTCATGGCCTCCAAGCAG
GCTGTCAAGTATGCCGGCAAGAGCCTCGAGGCTATGAAGGCTATTGCCCGTGCTCACGCCAACCGCTCCCTCGAC
GAGTACGAGCGCGCTCTCTCCCTCTACCGCTTCGAGCTTGGCAGCGATGCCTTTGTGCGCAACCATCTGCGCCGT
CTATATGATGCCATGCTTGAGCAAAACCTCATCAAGGTCATTGAGCCCTTTTCTCGCGTCCAGATTGACCACATT
GCCAAAATGGTGGCTCTCGATACCCTCCAAGTCGAGCGCAAGCTCTCCCAAATGATTCTCGACAAGGTCATTATT
GGCGTTCTCGACCAGGGTGCCGGCTGCCTCATCATTTACGACGAGACCCAGCGTGATGAGTCGTATGACGCTGCC
CTAGCAACCATTGACAAGCTAAGCAATGTTGTTGATGTCTTGTACACAAATCAGGCCTCCATGCTGGAGTAG
Transcript >OphauG2|7864
ATGGCAGCCGGCGAGTCGAGCCGGCTTCAAGAAGCCCAAGCCGTGCTGAAATCAGACCCCAAAAAGGCAGAGTCG
ATTTATCGCGGCATCGTCTCCAAGACGCCTCTTGCCGCCTCGGATGCCGCCACTCGCGAGTACGAGAGTGCTCTG
ATAAGCTTGGGCGAGCTGTACAGAGATCAAGCAAATATTCAAGACCTCGTCAGCCTGGTACGCGATAGTCGCTCC
GTCTTTTCGTCCTTTGCAAAGGCCAAGTCGTCAAAGCTGGTCCGGCAGCTGCTCGACCTCCTCCGCGAGATCCCC
AACAGCACCAATGTCGAAATCACCCTGACCAAGGACTGCATCGAGTGGGCCACCGCCGAGCGCCGCGCCTTTCAG
CGCCAGGACCTCGAGGTCCGTCTCGTCACGCTCTACATGAACAAGCAAGCCTACCACGACGCCCTCGCCCTCATC
ACCGGCCTGCTCCGTGAGCTCAAGCGCCTCGATGACAAGCTCCGCCTGGTCGAAGTCCAGCTCCTCGAGTCGCGA
GTCTACCACGCCCTCGGCAACATTGCCAAGGCCCGCGCCGCCCTCACCTCGGCCCGCACCAGCGCCGCCAGTGTC
TACACTCCTCCCCTCCTCCAAGCAAACCTTGACATGCAGAGCGGCATGCTGCACGCTGAAGACAAGGACTTCAAC
ACGGCTTTTTCATACTTTATCGAGGCCCTCGACGGCTACCACAGCTTAGACGAGAGCACCAAGGCCCAGGCCGCT
CTGCAGTACATGCTGCTCTGCAAAATCATGCTCAACCTCGTCCACGACGTGAACCAGCTCATGGCCTCCAAGCAG
GCTGTCAAGTATGCCGGCAAGAGCCTCGAGGCTATGAAGGCTATTGCCCGTGCTCACGCCAACCGCTCCCTCGAC
GAGTACGAGCGCGCTCTCTCCCTCTACCGCTTCGAGCTTGGCAGCGATGCCTTTGTGCGCAACCATCTGCGCCGT
CTATATGATGCCATGCTTGAGCAAAACCTCATCAAGGTCATTGAGCCCTTTTCTCGCGTCCAGATTGACCACATT
GCCAAAATGGTGGCTCTCGATACCCTCCAAGTCGAGCGCAAGCTCTCCCAAATGATTCTCGACAAGGTCATTATT
GGCGTTCTCGACCAGGGTGCCGGCTGCCTCATCATTTACGACGAGACCCAGCGTGATGAGTCGTATGACGCTGCC
CTAGCAACCATTGACAAGCTAAGCAATGTTGTTGATGTCTTGTACACAAATCAGGCCTCCATGCTGGAGTAG
Gene >OphauG2|7864
ATGGCAGCCGGCGAGTCGAGCCGGCTTCAAGAAGCCCAAGCCGTGCTGAAATCAGACCCCAAAAAGGCAGAGTCG
ATTTATCGCGGCATCGTCTCCAAGACGCCTCTTGCCGCCTCGGATGCCGCCACTCGCGAGTACGAGAGTGCTCTG
ATAAGCTTGGGCGAGCTGTACAGAGATCAAGCGTGCGTTTTCTGCCTTGCCCACCAGCATCCGGCCCCACGACAC
TACTGCATAGGCTGACACCATGTTTTTGGCGACACAGAAATATTCAAGACCTCGTCAGCCTGGTACGCGATAGTC
GCTCCGTCTTTTCGTCCTTTGCAAAGGCCAAGTCGTCAAAGCTGGGTCCGTTTATCCCGCCCAAAGCCCCAAAGG
AAAAAGAATTTGCCTCGCCACTGACACTAGGCAGTCCGGCAGCTGCTCGACCTCCTCCGCGAGATCCCCAACAGC
ACCAATGTCGAAATCACCCTGACCAAGGACTGCATCGAGTGGGCCACCGCCGAGCGCCGCGCCTTTCAGCGCCAG
GACCTCGAGGTCCGTCTCGTCACGCTCTACATGAACAAGCAAGCCTACCACGACGCCCTCGCCCTCATCACCGGC
CTGCTCCGTGAGCTCAAGCGCCTCGATGACAAGCTCCGCCTGGTCGAAGTCCAGCTCCTCGAGTCGCGAGTCTAC
CACGCCCTCGGCAACATTGCCAAGGCCCGCGCCGCCCTCACCTCGGCCCGCACCAGCGCCGCCAGTGTCTACACT
CCTCCCCTCCTCCAAGCAAACCTTGACATGCAGAGCGGCATGCTGCACGCTGAAGACAAGGACTTCAACACGGCT
TTTTCATACTTTATCGAGGCCCTCGACGGCTACCACAGCTTAGACGAGAGCACCAAGGCCCAGGCCGCTCTGCAG
TACATGCTGCTCTGCAAAATCATGCTCAACCTCGTCCACGACGTGAACCAGCTCATGGCCTCCAAGCAGGCTGTC
AAGTATGCCGGCAAGAGCCTCGAGGCTATGAAGGCTATTGCCCGTGCTCACGCCAACCGCTCCCTCGACGAGTAC
GAGCGCGCTCTCTCCCTCTACCGCTTCGAGCTTGGCAGCGATGCCTTTGTGCGCAACCATCTGCGCCGTCTATAT
GATGCCATGCTTGAGCAAAACCTCATCAAGGTCATTGAGCCCTTTTCTCGCGTCCAGATTGACCACATTGCCAAA
ATGGTGGCTCTCGATACCCTCCAAGTCGAGCGCAAGCTCTCCCAAATGATTCTCGACAAGGTCATTATTGGCGTT
CTCGACCAGGGTGCCGGCTGCCTCATCATTTACGACGAGACCCAGCGTGATGAGTCGTATGACGCTGCCCTAGCA
ACCATTGACAAGCTAAGCAATGTTGTTGATGTCTTGTACACAAATCAGGCCTCCATGCTGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail