Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7854
Gene name
LocationContig_962:7..538
Strand+
Gene length (bp)531
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74903|YCS3_SCHPO Uncharacterized calcium-binding protein C613.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.03 PE=3 SV=1 7 155 2.0E-23
sp|P39931|SS120_YEAST Protein SSP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSP120 PE=1 SV=1 4 119 2.0E-20

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1542
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7854 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7470
Ophiocordyceps camponoti-floridani Ophcf2|04954
Ophiocordyceps camponoti-rufipedis Ophun1|5595
Ophiocordyceps kimflemingae Ophio5|6114
Ophiocordyceps subramaniannii Hirsu2|11253

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7854
MCLWDPDSFFTLHDFNNDGLWKPDELQRLYGLKDPSSKDISTERRDQVTRELLALLDLDGDGAVSRSEWLSFTAQ
GRTLPDMGTGPGHHGDDEYEYEIHHWEKYHDENTKLEDLTHPEDIEHFKMHENLEKAAEELEALEKRPIVEENIP
AKFRRS*
Coding >OphauG2|7854
ATGTGCCTTTGGGACCCCGATTCCTTCTTTACCCTGCACGACTTCAACAACGATGGCCTCTGGAAGCCGGATGAG
TTGCAGCGGTTGTATGGCCTCAAGGACCCGTCAAGCAAGGACATATCAACTGAGCGTCGCGACCAAGTGACGCGC
GAACTGCTGGCACTGCTCGACCTGGATGGCGACGGCGCTGTCAGCCGTTCGGAATGGTTGTCCTTTACTGCTCAG
GGCCGCACGCTGCCGGACATGGGCACCGGACCTGGCCACCACGGCGACGATGAGTACGAGTACGAGATTCACCAC
TGGGAAAAGTACCACGACGAAAACACAAAGCTCGAGGACCTGACACATCCCGAGGATATTGAGCATTTCAAGATG
CACGAGAATCTCGAAAAGGCGGCAGAGGAGCTCGAGGCCCTGGAGAAGCGGCCCATTGTTGAAGAGAACATCCCG
GCCAAGTTTCGCCGCTCGTGA
Transcript >OphauG2|7854
ATGTGCCTTTGGGACCCCGATTCCTTCTTTACCCTGCACGACTTCAACAACGATGGCCTCTGGAAGCCGGATGAG
TTGCAGCGGTTGTATGGCCTCAAGGACCCGTCAAGCAAGGACATATCAACTGAGCGTCGCGACCAAGTGACGCGC
GAACTGCTGGCACTGCTCGACCTGGATGGCGACGGCGCTGTCAGCCGTTCGGAATGGTTGTCCTTTACTGCTCAG
GGCCGCACGCTGCCGGACATGGGCACCGGACCTGGCCACCACGGCGACGATGAGTACGAGTACGAGATTCACCAC
TGGGAAAAGTACCACGACGAAAACACAAAGCTCGAGGACCTGACACATCCCGAGGATATTGAGCATTTCAAGATG
CACGAGAATCTCGAAAAGGCGGCAGAGGAGCTCGAGGCCCTGGAGAAGCGGCCCATTGTTGAAGAGAACATCCCG
GCCAAGTTTCGCCGCTCGTGA
Gene >OphauG2|7854
ATGTGCCTGTGCCGGCTCCAGAGGTGCTGCTAACCACGCTTCACTACAGAGGAGCACCACTTGACAAGTTGGGAC
CCCGATTCCTTCTTTACCCTGCACGACTTCAACAACGATGGCCTCTGGAAGCCGGATGAGTTGCAGCGGTTGTAT
GGCCTCAAGGACCCGTCAAGCAAGGACATATCAACTGAGCGTCGCGACCAAGTGACGCGCGAACTGCTGGCACTG
CTCGACCTGGATGGCGACGGCGCTGTCAGCCGTTCGGAATGGTTGTCCTTTACTGCTCAGGGCCGCACGCTGCCG
GACATGGGCACCGGACCTGGCCACCACGGCGACGATGAGTACGAGTACGAGATTCACCACTGGGAAAAGTACCAC
GACGAAAACACAAAGCTCGAGGACCTGACACATCCCGAGGATATTGAGCATTTCAAGATGCACGAGAATCTCGAA
AAGGCGGCAGAGGAGCTCGAGGCCCTGGAGAAGCGGCCCATTGTTGAAGAGAACATCCCGGCCAAGTTTCGCCGC
TCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail