Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7851
Gene name
LocationContig_961:120..2226
Strand-
Gene length (bp)2106
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11699 CENP-C_C Mif2/CENP-C like 1.4E-32 533 617
PF15624 Mif2_N Kinetochore CENP-C fungal homologue, Mif2, N-terminal 3.3E-21 18 122

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P49452|CENPC_MOUSE Centromere protein C OS=Mus musculus GN=Cenpc PE=1 SV=2 399 617 1.0E-13
sp|Q03188|CENPC_HUMAN Centromere protein C OS=Homo sapiens GN=CENPC PE=1 SV=2 399 617 2.0E-13
sp|P49453|CENPC_SHEEP Centromere protein C (Fragment) OS=Ovis aries GN=CENPC PE=2 SV=1 399 618 7.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7851 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6509
Ophiocordyceps camponoti-floridani Ophcf2|06602
Ophiocordyceps camponoti-rufipedis Ophun1|391
Ophiocordyceps kimflemingae Ophio5|5807
Ophiocordyceps subramaniannii Hirsu2|2457

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7851
MGHAQHANVSTFAAGHSKTGVSLPEGGERDEHGMQRLDGIFSPAANGAADSEGEDMDIDSSAGPGPRTLLQNQRS
KLSMPKSWSPAKTSLNSPARRMPPPEPQAVRRSAAPDDQPLSRKLDFGSKAKPPPKDPRAVNGATRDGRREPGSD
AHGDVSGIGEESLLLVDASAETMRQSTGHVEVQKRAGMQDEEGEDEDEDEVVPAPRRRGRPRKNPESAPKPKPEQ
ASNKRPATQSSGANSNGHGRSEPREQDQDDEEPRQAKRKRTQDASQELPKAAPQQARKRAAQEAPKQAVRAASPA
TTASRAASPSPAPPPPSQPLSKTWQAKAGAPDAKPQQRPRGRPASKVKPRAEANNNNNNNEDDDTGESSLAELQR
GPPMPKSRGLVSVRRNPDGITQTRSGRHSFRPLDYWRGEMAVRQDEQRSDMFHSDAFVLPSVKEIVRVPADAPPH
AKRSAGPSGAGKLSRKAKLASRETPELEDWEIDPGTVTGEVVVWEPEHERHPPADDEPVQVMDDRIAISAGAIRT
SDIKDATFRFAKTLTTPFMGAGVVDLPPSSEKRPKNSRKMHMVFFVHYGKVLVTINDAQFRISAGGTWFVPRGNY
YSVTNDYDAPARVFFAQACEVPAPQASAKDSQLAPDDSQLAPDDSQLSVPQS*
Coding >OphauG2|7851
ATGGGCCACGCTCAGCATGCTAATGTTTCAACCTTTGCGGCTGGCCACAGCAAAACGGGCGTGTCGCTGCCCGAA
GGCGGTGAGCGCGACGAGCATGGCATGCAGCGCCTCGATGGCATCTTTTCGCCCGCTGCCAATGGCGCTGCAGAC
TCGGAGGGCGAAGACATGGACATTGACTCGAGTGCTGGGCCAGGCCCGCGGACACTGCTGCAGAACCAGCGCAGC
AAACTCTCCATGCCCAAGAGCTGGTCGCCCGCCAAGACGAGTCTCAACTCGCCTGCACGCAGGATGCCGCCACCA
GAGCCGCAGGCTGTACGGCGGTCGGCTGCGCCTGACGACCAACCGCTTAGTCGCAAACTCGACTTTGGCTCCAAG
GCTAAGCCGCCGCCCAAGGACCCGCGGGCAGTTAATGGCGCAACCCGGGATGGTCGACGCGAGCCGGGTAGCGAC
GCACATGGTGATGTGAGCGGCATAGGGGAGGAGTCATTGTTATTGGTCGACGCCAGCGCCGAAACCATGCGTCAG
AGTACGGGCCACGTTGAGGTCCAGAAAAGGGCTGGTATGCAAGATGAAGAAGGCGAGGACGAGGACGAGGACGAG
GTTGTGCCTGCTCCGCGCCGAAGAGGCCGGCCGCGCAAGAATCCCGAGTCAGCTCCAAAGCCAAAGCCAGAGCAG
GCATCCAACAAGAGACCAGCAACACAGAGCTCGGGCGCCAACAGCAATGGCCATGGCCGGTCAGAACCAAGAGAG
CAAGACCAAGATGACGAGGAACCGAGACAAGCCAAGCGGAAACGCACCCAGGACGCGTCTCAAGAGCTTCCCAAG
GCAGCTCCGCAGCAGGCTCGTAAGAGAGCTGCCCAAGAGGCTCCCAAACAAGCCGTCCGAGCAGCTTCTCCAGCG
ACTACAGCTTCGCGGGCTGCGTCTCCATCTCCTGCTCCTCCTCCTCCTTCTCAGCCCTTGTCAAAGACGTGGCAA
GCAAAAGCAGGGGCTCCGGATGCCAAGCCTCAGCAGAGACCACGAGGCCGTCCCGCAAGCAAAGTCAAGCCCCGG
GCCGAAGCAAACAACAATAACAACAATAACGAGGACGACGACACAGGCGAATCGTCGCTTGCTGAACTGCAGCGC
GGGCCGCCAATGCCCAAGTCTCGCGGCCTCGTCTCTGTGCGCCGCAACCCCGATGGCATTACGCAGACGCGCTCC
GGCAGACACTCGTTCCGCCCCCTCGACTACTGGCGCGGCGAGATGGCTGTGCGGCAAGACGAACAGCGCAGCGAC
ATGTTTCACTCTGACGCCTTTGTGCTGCCCTCGGTCAAGGAAATCGTGCGCGTGCCGGCCGACGCGCCGCCTCAT
GCCAAGCGCTCCGCCGGCCCGTCGGGCGCAGGCAAGCTGTCGCGCAAGGCCAAGCTGGCGTCGCGCGAGACGCCT
GAGCTCGAGGACTGGGAGATTGACCCGGGCACTGTGACGGGCGAGGTTGTTGTCTGGGAACCCGAGCACGAGAGG
CACCCGCCTGCCGACGACGAGCCGGTGCAGGTCATGGACGACCGCATCGCCATTTCCGCAGGCGCCATCCGCACC
TCGGACATTAAAGACGCCACGTTTCGCTTTGCCAAGACGTTGACGACGCCATTCATGGGCGCGGGTGTGGTGGAT
TTGCCGCCGAGTAGTGAGAAGCGGCCCAAGAACTCGCGCAAGATGCACATGGTGTTTTTTGTCCACTATGGCAAG
GTGCTCGTCACCATTAACGATGCCCAGTTTCGCATCTCGGCCGGCGGCACCTGGTTTGTGCCTCGCGGCAACTAC
TACAGCGTCACAAACGACTACGACGCCCCCGCACGCGTCTTTTTTGCCCAGGCCTGCGAAGTCCCGGCTCCCCAA
GCCTCAGCCAAAGACTCCCAACTCGCCCCCGACGACTCCCAACTCGCCCCCGATGACTCCCAACTCTCGGTCCCC
CAATCCTAA
Transcript >OphauG2|7851
ATGGGCCACGCTCAGCATGCTAATGTTTCAACCTTTGCGGCTGGCCACAGCAAAACGGGCGTGTCGCTGCCCGAA
GGCGGTGAGCGCGACGAGCATGGCATGCAGCGCCTCGATGGCATCTTTTCGCCCGCTGCCAATGGCGCTGCAGAC
TCGGAGGGCGAAGACATGGACATTGACTCGAGTGCTGGGCCAGGCCCGCGGACACTGCTGCAGAACCAGCGCAGC
AAACTCTCCATGCCCAAGAGCTGGTCGCCCGCCAAGACGAGTCTCAACTCGCCTGCACGCAGGATGCCGCCACCA
GAGCCGCAGGCTGTACGGCGGTCGGCTGCGCCTGACGACCAACCGCTTAGTCGCAAACTCGACTTTGGCTCCAAG
GCTAAGCCGCCGCCCAAGGACCCGCGGGCAGTTAATGGCGCAACCCGGGATGGTCGACGCGAGCCGGGTAGCGAC
GCACATGGTGATGTGAGCGGCATAGGGGAGGAGTCATTGTTATTGGTCGACGCCAGCGCCGAAACCATGCGTCAG
AGTACGGGCCACGTTGAGGTCCAGAAAAGGGCTGGTATGCAAGATGAAGAAGGCGAGGACGAGGACGAGGACGAG
GTTGTGCCTGCTCCGCGCCGAAGAGGCCGGCCGCGCAAGAATCCCGAGTCAGCTCCAAAGCCAAAGCCAGAGCAG
GCATCCAACAAGAGACCAGCAACACAGAGCTCGGGCGCCAACAGCAATGGCCATGGCCGGTCAGAACCAAGAGAG
CAAGACCAAGATGACGAGGAACCGAGACAAGCCAAGCGGAAACGCACCCAGGACGCGTCTCAAGAGCTTCCCAAG
GCAGCTCCGCAGCAGGCTCGTAAGAGAGCTGCCCAAGAGGCTCCCAAACAAGCCGTCCGAGCAGCTTCTCCAGCG
ACTACAGCTTCGCGGGCTGCGTCTCCATCTCCTGCTCCTCCTCCTCCTTCTCAGCCCTTGTCAAAGACGTGGCAA
GCAAAAGCAGGGGCTCCGGATGCCAAGCCTCAGCAGAGACCACGAGGCCGTCCCGCAAGCAAAGTCAAGCCCCGG
GCCGAAGCAAACAACAATAACAACAATAACGAGGACGACGACACAGGCGAATCGTCGCTTGCTGAACTGCAGCGC
GGGCCGCCAATGCCCAAGTCTCGCGGCCTCGTCTCTGTGCGCCGCAACCCCGATGGCATTACGCAGACGCGCTCC
GGCAGACACTCGTTCCGCCCCCTCGACTACTGGCGCGGCGAGATGGCTGTGCGGCAAGACGAACAGCGCAGCGAC
ATGTTTCACTCTGACGCCTTTGTGCTGCCCTCGGTCAAGGAAATCGTGCGCGTGCCGGCCGACGCGCCGCCTCAT
GCCAAGCGCTCCGCCGGCCCGTCGGGCGCAGGCAAGCTGTCGCGCAAGGCCAAGCTGGCGTCGCGCGAGACGCCT
GAGCTCGAGGACTGGGAGATTGACCCGGGCACTGTGACGGGCGAGGTTGTTGTCTGGGAACCCGAGCACGAGAGG
CACCCGCCTGCCGACGACGAGCCGGTGCAGGTCATGGACGACCGCATCGCCATTTCCGCAGGCGCCATCCGCACC
TCGGACATTAAAGACGCCACGTTTCGCTTTGCCAAGACGTTGACGACGCCATTCATGGGCGCGGGTGTGGTGGAT
TTGCCGCCGAGTAGTGAGAAGCGGCCCAAGAACTCGCGCAAGATGCACATGGTGTTTTTTGTCCACTATGGCAAG
GTGCTCGTCACCATTAACGATGCCCAGTTTCGCATCTCGGCCGGCGGCACCTGGTTTGTGCCTCGCGGCAACTAC
TACAGCGTCACAAACGACTACGACGCCCCCGCACGCGTCTTTTTTGCCCAGGCCTGCGAAGTCCCGGCTCCCCAA
GCCTCAGCCAAAGACTCCCAACTCGCCCCCGACGACTCCCAACTCGCCCCCGATGACTCCCAACTCTCGGTCCCC
CAATCCTAA
Gene >OphauG2|7851
ATGGGCCACGCTCAGCATGCTAATGTTTCAACCTTTGCGGCTGGCCACAGCAAAACGGGCGTGTCGCTGCCCGAA
GGCGGTGAGCGCGACGAGCATGGCATGCAGCGCCTCGATGGCATCTTTTCGCCCGCTGCCAATGGCGCTGCAGAC
TCGGAGGGCGAAGACATGGACATTGACTCGAGTGAGCCTTGCGTGCATCTATGCGAGACGGGCCGCCATTGCTGA
CGGACGGCACAGGTGCTGGGCCAGGCCCGCGGACACTGCTGCAGAACCAGCGCAGCAAACTCTCCATGCCCAAGA
GCTGGTCGCCCGCCAAGACGAGTCTCAACTCGCCTGCACGCAGGATGCCGCCACCAGAGCCGCAGGCTGTACGGC
GGTCGGCTGCGCCTGACGACCAACCGCTTAGTCGCAAACTCGACTTTGGCTCCAAGGCTAAGCCGCCGCCCAAGG
ACCCGCGGGCAGTTAATGGCGCAACCCGGGATGGTCGACGCGAGCCGGGTAGCGACGCACATGGTGATGTGAGCG
GCATAGGGGAGGAGTCATTGTTATTGGTCGACGCCAGCGCCGAAACCATGCGTCAGAGTACGGGCCACGTTGAGG
TCCAGAAAAGGGCTGGTATGCAAGATGAAGAAGGCGAGGACGAGGACGAGGACGAGGTTGTGCCTGCTCCGCGCC
GAAGAGGCCGGCCGCGCAAGAATCCCGAGTCAGCTCCAAAGCCAAAGCCAGAGCAGGCATCCAACAAGAGACCAG
CAACACAGAGCTCGGGCGCCAACAGCAATGGCCATGGCCGGTCAGAACCAAGAGAGCAAGACCAAGATGACGAGG
AACCGAGACAAGCCAAGCGGAAACGCACCCAGGACGCGTCTCAAGAGCTTCCCAAGGCAGCTCCGCAGCAGGCTC
GTAAGAGAGCTGCCCAAGAGGCTCCCAAACAAGCCGTCCGAGCAGCTTCTCCAGCGACTACAGCTTCGCGGGCTG
CGTCTCCATCTCCTGCTCCTCCTCCTCCTTCTCAGCCCTTGTCAAAGACGTGGCAAGCAAAAGCAGGGGCTCCGG
ATGCCAAGCCTCAGCAGAGACCACGAGGCCGTCCCGCAAGCAAAGTCAAGCCCCGGGCCGAAGCAAACAACAATA
ACAACAATAACGAGGACGACGACACAGGCGAATCGTCGCTTGCTGAACTGCAGCGCGGGCCGCCAATGCCCAAGT
CTCGCGGCCTCGTCTCTGTGCGCCGCAACCCCGATGGCATTACGCAGACGCGCTCCGGCAGACACTCGTTCCGCC
CCCTCGACTACTGGCGCGGCGAGATGGCTGTGCGGCAAGACGAACAGCGCAGCGACATGTTTCACTCTGACGCCT
TTGTGCTGCCCTCGGTCAAGGAAATCGTGCGCGTGCCGGCCGACGCGCCGCCTCATGCCAAGCGCTCCGCCGGCC
CGTCGGGCGCAGGCAAGCTGTCGCGCAAGGCCAAGCTGGCGTCGCGCGAGACGCCTGAGCTCGAGGACTGGGAGA
TTGACCCGGGCACTGTGACGGGCGAGGTTGTTGTCTGGGAACCCGAGCACGAGAGGCACCCGCCTGCCGACGACG
AGCCGGTGCAGGTCATGGACGACCGCATCGCCATTTCCGCAGGCGCCATCCGCACCTCGGACATTAAAGACGCCA
CGTTTCGCTTTGCCAAGACGTTGACGACGCCATTCATGGGCGCGGGTGTGGTGGATTTGCCGCCGAGTAGTGAGA
AGCGGCCCAAGAACTCGCGCAAGATGCACATGGTGTTTTTTGTCCACTATGGCAAGGTGCTCGTCACCATTAACG
ATGCCCAGTTTCGCATCTCGGCCGGCGGCACCTGGTTTGTGCCTCGCGGTATGTCTATTGGCCTCTTGATCTCTC
TGACCTCTATTCTTTCTCTCACACTCGCACGCACACTCTCTCTACAACCACTTACTCTCTACAGGCAACTACTAC
AGCGTCACAAACGACTACGACGCCCCCGCACGCGTCTTTTTTGCCCAGGCCTGCGAAGTCCCGGCTCCCCAAGCC
TCAGCCAAAGACTCCCAACTCGCCCCCGACGACTCCCAACTCGCCCCCGATGACTCCCAACTCTCGGTCCCCCAA
TCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail