Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7841
Gene name
LocationContig_96:14990..16219
Strand-
Gene length (bp)1229
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3712
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7841 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6467
Ophiocordyceps camponoti-floridani Ophcf2|03894
Ophiocordyceps camponoti-rufipedis Ophun1|4836
Ophiocordyceps kimflemingae Ophio5|7203
Ophiocordyceps subramaniannii Hirsu2|7230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7841
MSMDTLFDSIPTRLLTRLRRLHLAVPPADASDDDEANASSSSASHSNVYEPTPFDVVVTRVMLGRSMKLPPDLVD
CIFDYAEYWAHSTSVVEDNSGGDPNQFLLRSYPLGLTSITGKDSANIAEELAYDCNEAKPLPLAREHEPQFFARL
VDYPTPRLLHPCRKIVFTIRSHDQGWGGDADTQGTYRSSWTWFEAGLERFDASQMCDSKCTYDVRSERPESTAPL
LPVCALRPVVPKIEPAGPEPDNYRYSHELLPQEELVIQRNKVATRKTQEHVVQWSWEDKTDQASAAARQLDEAGR
GRATCDGAFVRELRLGDVVTVWGKARFPGWVNYADLVRIDIYWLV*
Coding >OphauG2|7841
ATGTCCATGGACACGCTATTCGATTCCATTCCCACACGCCTCTTGACCCGCCTCCGCCGACTGCACCTGGCCGTA
CCGCCGGCCGACGCCAGCGACGACGATGAAGCAAACGCCTCGTCATCCTCGGCCAGCCATAGCAATGTCTATGAG
CCTACGCCCTTTGACGTGGTGGTGACACGGGTCATGCTGGGCCGCAGCATGAAACTGCCGCCCGACTTGGTCGAC
TGCATCTTTGACTATGCTGAGTACTGGGCGCACTCGACCAGTGTCGTTGAAGACAACAGCGGAGGGGACCCCAAC
CAATTTCTGCTTCGATCATATCCTCTGGGCTTGACCTCGATTACGGGCAAAGATTCCGCCAACATTGCAGAGGAA
CTTGCCTATGACTGCAACGAAGCCAAGCCCTTGCCCCTTGCGAGAGAGCATGAGCCTCAGTTCTTTGCTCGCCTC
GTCGACTATCCGACGCCGCGACTATTGCATCCATGCCGCAAGATTGTCTTCACCATCCGAAGCCACGACCAGGGC
TGGGGCGGCGACGCTGATACCCAGGGCACATATCGGTCGTCGTGGACCTGGTTTGAGGCTGGGCTCGAGCGTTTT
GACGCCAGCCAGATGTGCGATAGCAAGTGTACCTACGATGTTCGCAGCGAACGACCCGAGTCGACAGCGCCGCTG
CTACCCGTTTGTGCACTTCGCCCCGTGGTGCCCAAGATTGAGCCAGCTGGGCCCGAGCCGGACAATTACCGCTAT
TCCCATGAGCTTTTACCTCAAGAGGAGCTGGTTATTCAGCGCAACAAGGTGGCGACGCGTAAGACGCAAGAGCAT
GTGGTTCAGTGGTCGTGGGAGGATAAAACAGATCAGGCCTCGGCAGCGGCCCGCCAGCTTGATGAGGCGGGACGA
GGCCGGGCAACTTGTGACGGGGCCTTTGTCCGAGAGCTGCGCTTAGGCGATGTCGTGACCGTCTGGGGCAAGGCC
CGTTTTCCCGGATGGGTCAATTACGCCGACCTGGTTCGCATCGATATCTACTGGCTGGTCTGA
Transcript >OphauG2|7841
ATGTCCATGGACACGCTATTCGATTCCATTCCCACACGCCTCTTGACCCGCCTCCGCCGACTGCACCTGGCCGTA
CCGCCGGCCGACGCCAGCGACGACGATGAAGCAAACGCCTCGTCATCCTCGGCCAGCCATAGCAATGTCTATGAG
CCTACGCCCTTTGACGTGGTGGTGACACGGGTCATGCTGGGCCGCAGCATGAAACTGCCGCCCGACTTGGTCGAC
TGCATCTTTGACTATGCTGAGTACTGGGCGCACTCGACCAGTGTCGTTGAAGACAACAGCGGAGGGGACCCCAAC
CAATTTCTGCTTCGATCATATCCTCTGGGCTTGACCTCGATTACGGGCAAAGATTCCGCCAACATTGCAGAGGAA
CTTGCCTATGACTGCAACGAAGCCAAGCCCTTGCCCCTTGCGAGAGAGCATGAGCCTCAGTTCTTTGCTCGCCTC
GTCGACTATCCGACGCCGCGACTATTGCATCCATGCCGCAAGATTGTCTTCACCATCCGAAGCCACGACCAGGGC
TGGGGCGGCGACGCTGATACCCAGGGCACATATCGGTCGTCGTGGACCTGGTTTGAGGCTGGGCTCGAGCGTTTT
GACGCCAGCCAGATGTGCGATAGCAAGTGTACCTACGATGTTCGCAGCGAACGACCCGAGTCGACAGCGCCGCTG
CTACCCGTTTGTGCACTTCGCCCCGTGGTGCCCAAGATTGAGCCAGCTGGGCCCGAGCCGGACAATTACCGCTAT
TCCCATGAGCTTTTACCTCAAGAGGAGCTGGTTATTCAGCGCAACAAGGTGGCGACGCGTAAGACGCAAGAGCAT
GTGGTTCAGTGGTCGTGGGAGGATAAAACAGATCAGGCCTCGGCAGCGGCCCGCCAGCTTGATGAGGCGGGACGA
GGCCGGGCAACTTGTGACGGGGCCTTTGTCCGAGAGCTGCGCTTAGGCGATGTCGTGACCGTCTGGGGCAAGGCC
CGTTTTCCCGGATGGGTCAATTACGCCGACCTGGTTCGCATCGATATCTACTGGCTGGTCTGA
Gene >OphauG2|7841
ATGTCCATGGACACGCTATTCGGTCGGTCAATATCCATCTGTATTTGCAGTCTTGCGTCATCATCTTGACACCCA
CCATGGCAGATTCCATTCCCACACGCCTCTTGACCCGCCTCCGCCGACTGCACCTGGCCGTACCGCCGGCCGACG
CCAGCGACGACGATGAAGCAAACGCCTCGTCATCCTCGGCCAGCCATAGCAATGTCTATGAGCCTACGCCCTTTG
ACGTGGTGGTGACACGGGTCATGCTGGGCCGCAGCATGAAACTGCCGCCCGACTTGGTCGACTGCATCTTTGACT
ATGCTGAGTACTGGGCGCACTCGACCAGTGTCGTTGAAGACAACAGCGGAGGGGACCCCAACCAATTTCTGGTCC
GCATACCAAACAAGGACCCATGCGTGGGCCAAGTCGTTGATGATGGCCTCTAGCTTCGATCATATCCTCTGGGCT
TGACCTCGATTACGGGCAAAGATTCCGCCAACATTGCAGAGGAACTTGCCTATGACTGCAACGAAGCCAAGCCCT
TGCCCCTTGCGAGAGAGCATGAGCCTCAGTTCTTTGCTCGCCTCGTCGACTATCCGACGCCGCGACTATTGCATC
CATGCCGCAAGATTGTCTTCACCATCCGAAGCCACGACCAGGGCTGGGGCGGCGACGCTGATACCCAGGGCACAT
ATCGGTCGTCGTGGACCTGGTTTGAGGCTGGGCTCGAGCGTTTTGACGCCAGCCAGATGTGTAAGTGCCAGAAAC
AAATCTCAACAACTAGAGTTGCCTCTCGCCAAGCTGCTGACACTACAACCCGCTCAGGCGATAGCAAGTGTACCT
ACGATGTTCGCAGCGAACGACCCGAGTCGACAGCGCCGCTGCTACCCGTTTGTGCACTTCGCCCCGTGGTGCCCA
AGATTGAGCCAGCTGGGCCCGAGCCGGACAATTACCGCTATTCCCATGAGCTTTTACCTCAAGAGGAGCTGGTTA
TTCAGCGCAACAAGGTGGCGACGCGTAAGACGCAAGAGCATGTGGTTCAGTGGTCGTGGGAGGATAAAACAGATC
AGGCCTCGGCAGCGGCCCGCCAGCTTGATGAGGCGGGACGAGGCCGGGCAACTTGTGACGGGGCCTTTGTCCGAG
AGCTGCGCTTAGGCGATGTCGTGACCGTCTGGGGCAAGGCCCGTTTTCCCGGATGGGTCAATTACGCCGACCTGG
TTCGCATCGATATCTACTGGCTGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail