Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|784
Gene name
LocationContig_120:7256..7722
Strand-
Gene length (bp)466
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999787

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6738
Ophiocordyceps australis 1348a (Ghana) OphauG2|784 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1368
Ophiocordyceps australis map64 (Brazil) OphauB2|4853
Ophiocordyceps camponoti-floridani Ophcf2|06380
Ophiocordyceps camponoti-floridani Ophcf2|06854
Ophiocordyceps camponoti-rufipedis Ophun1|3358
Ophiocordyceps camponoti-rufipedis Ophun1|7054
Ophiocordyceps kimflemingae Ophio5|3331
Ophiocordyceps kimflemingae Ophio5|6004
Ophiocordyceps subramaniannii Hirsu2|56
Ophiocordyceps subramaniannii Hirsu2|9193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|784
MVRIYAFATLFALALTVSAEEPGQANIGNGAGKQFITGSCLSDADCASGCCATKAGKGVCSAKLVANEDGKEGCG
FGGSSAGGNNGGAGNNGKTGGRGNRSAKNRTNNNGATQGQTQVLGQIDANGQCVCNAS*
Coding >OphauG2|784
ATGGTTCGAATTTACGCCTTTGCCACTCTTTTTGCTTTGGCCTTGACAGTCTCGGCAGAAGAGCCTGGCCAAGCA
AACATTGGCAACGGCGCCGGCAAGCAATTCATCACTGGCAGCTGTCTGAGCGACGCCGACTGCGCGTCGGGATGC
TGCGCCACCAAGGCAGGCAAGGGCGTGTGCTCCGCCAAATTGGTTGCGAATGAAGACGGCAAGGAGGGCTGCGGC
TTTGGTGGCAGCAGCGCCGGCGGCAATAATGGAGGTGCTGGGAATAACGGCAAGACTGGCGGCAGAGGAAATCGA
AGTGCCAAGAACAGGACCAATAACAATGGGGCGACGCAAGGACAGACTCAGGTGCTGGGGCAGATTGATGCCAAT
GGGCAGTGTGTCTGCAACGCCAGCTAG
Transcript >OphauG2|784
ATGGTTCGAATTTACGCCTTTGCCACTCTTTTTGCTTTGGCCTTGACAGTCTCGGCAGAAGAGCCTGGCCAAGCA
AACATTGGCAACGGCGCCGGCAAGCAATTCATCACTGGCAGCTGTCTGAGCGACGCCGACTGCGCGTCGGGATGC
TGCGCCACCAAGGCAGGCAAGGGCGTGTGCTCCGCCAAATTGGTTGCGAATGAAGACGGCAAGGAGGGCTGCGGC
TTTGGTGGCAGCAGCGCCGGCGGCAATAATGGAGGTGCTGGGAATAACGGCAAGACTGGCGGCAGAGGAAATCGA
AGTGCCAAGAACAGGACCAATAACAATGGGGCGACGCAAGGACAGACTCAGGTGCTGGGGCAGATTGATGCCAAT
GGGCAGTGTGTCTGCAACGCCAGCTAG
Gene >OphauG2|784
ATGGTTCGAATTTACGCCTTTGCCACTCTTTTTGCTTGTAAGCCCCACCCCAGCTTGAATCATCTCAACGACAAC
TCTTACTGACTTTTTCGAACCTCTAGTGGCCTTGACAGTCTCGGCAGAAGAGCCTGGCCAAGCAAACATTGGCAA
CGGCGCCGGCAAGCAATTCATCACTGGCAGCTGTCTGAGCGACGCCGACTGCGCGTCGGGATGCTGCGCCACCAA
GGCAGGCAAGGGCGTGTGCTCCGCCAAATTGGTTGCGAATGAAGACGGCAAGGAGGGCTGCGGCTTTGGTGGCAG
CAGCGCCGGCGGCAATAATGGAGGTGCTGGGAATAACGGCAAGACTGGCGGCAGAGGAAATCGAAGTGCCAAGAA
CAGGACCAATAACAATGGGGCGACGCAAGGACAGACTCAGGTGCTGGGGCAGATTGATGCCAATGGGCAGTGTGT
CTGCAACGCCAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail