Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7837
Gene name
LocationContig_96:1210..2323
Strand+
Gene length (bp)1113
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.8E-15 86 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 84 165 1.0E-15
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 88 173 2.0E-15
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 84 161 5.0E-15
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 84 161 5.0E-15
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 84 161 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 84 165 1.0E-15
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 88 173 2.0E-15
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 84 161 5.0E-15
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 84 161 5.0E-15
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 84 161 7.0E-15
sp|Q5NVM8|RNPS1_PONAB RNA-binding protein with serine-rich domain 1 OS=Pongo abelii GN=RNPS1 PE=2 SV=1 84 161 5.0E-14
sp|Q99M28|RNPS1_MOUSE RNA-binding protein with serine-rich domain 1 OS=Mus musculus GN=Rnps1 PE=2 SV=1 84 161 5.0E-14
sp|Q4R5N1|RNPS1_MACFA RNA-binding protein with serine-rich domain 1 OS=Macaca fascicularis GN=RNPS1 PE=2 SV=1 84 161 5.0E-14
sp|Q15287|RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens GN=RNPS1 PE=1 SV=1 84 161 5.0E-14
sp|A6QR16|RNPS1_BOVIN RNA-binding protein with serine-rich domain 1 OS=Bos taurus GN=RNPS1 PE=2 SV=1 84 161 5.0E-14
sp|Q6AYK1|RNPS1_RAT RNA-binding protein with serine-rich domain 1 OS=Rattus norvegicus GN=Rnps1 PE=2 SV=1 84 161 5.0E-14
sp|Q1MTR2|RNPS1_SCHPO RNA-binding protein with serine-rich domain 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.14c PE=3 SV=2 86 159 5.0E-12
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 78 172 3.0E-08
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 78 172 3.0E-08
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 78 172 3.0E-08
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 78 172 3.0E-08
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 78 172 9.0E-08
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 78 172 9.0E-08
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 76 163 1.0E-07
sp|Q9R0U0|SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus GN=Srsf10 PE=1 SV=2 83 179 4.0E-07
sp|O75494|SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens GN=SRSF10 PE=1 SV=1 83 179 4.0E-07
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 85 157 6.0E-07
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 86 172 7.0E-07
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 42 147 8.0E-07
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 85 157 9.0E-07
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 85 157 9.0E-07
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 85 158 1.0E-06
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 86 159 1.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 85 194 1.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 85 194 1.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 85 194 1.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 85 194 1.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 85 194 1.0E-06
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 85 157 1.0E-06
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 85 157 1.0E-06
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 85 157 1.0E-06
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 86 165 2.0E-06
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 85 157 2.0E-06
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 85 157 2.0E-06
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 85 157 2.0E-06
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 85 157 2.0E-06
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 85 157 3.0E-06
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 83 163 5.0E-06
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 85 301 5.0E-06
sp|Q8WXF0|SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens GN=SRSF12 PE=2 SV=1 83 160 9.0E-06
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 86 170 9.0E-06
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 83 160 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7837
MAPRSLSPSPPRGRMRSRTRSPSRRSDDSRRRRYPSRSATRSPSPAMRRNGRRGSESRSRSRSRAYARDGGGFGP
REAPPVMGTKIVVERLSKNVTESHLREIFGYYGPIQDLDLPLNRTFGTNRGTAYILYEHREDAEEAIANMHDGQI
DGTVINVSIVLPRRMFSPPPPLARRGANIDPRVPFNGSRGGRGGRMRHSPGYDYNGPPRGPSRRYPPSPGRHGPP
MDPYPPSLRSRSRSQSPPRGPRPYGRGRPPSRSRYSRSPSRSMSPRPRHHNDRNDYAPRRRSRSRNYDYNGDDRR
YPVSPGRG*
Coding >OphauG2|7837
ATGGCTCCGCGCTCCCTCTCGCCCTCGCCGCCACGGGGCCGCATGCGCTCTCGCACACGCTCACCATCGCGTCGC
TCAGACGACTCGCGCCGCCGTCGCTACCCGTCGCGCTCTGCTACGCGCTCGCCTTCGCCCGCCATGCGTCGCAAT
GGCCGCCGTGGGAGCGAGTCTCGAAGCCGTAGTCGCAGCCGTGCTTATGCAAGGGATGGAGGAGGCTTCGGGCCT
AGAGAGGCGCCGCCAGTCATGGGAACCAAGATTGTCGTTGAGCGCCTCTCCAAAAACGTGACCGAGTCGCATCTC
CGCGAAATATTTGGCTACTACGGCCCCATTCAAGACCTTGACCTCCCCTTGAACCGCACCTTCGGCACAAACCGC
GGCACCGCATACATCCTGTACGAGCACCGCGAAGACGCCGAAGAGGCCATTGCCAACATGCACGACGGCCAAATC
GACGGCACCGTTATCAACGTGTCCATTGTCCTCCCCCGCCGCATGTTCTCGCCCCCGCCTCCGCTTGCCCGCCGC
GGTGCAAACATTGATCCTCGCGTTCCCTTTAATGGCTCTCGCGGCGGTCGCGGCGGCCGTATGCGCCATAGTCCA
GGCTACGACTATAACGGCCCTCCTCGAGGCCCGAGCCGTCGCTACCCGCCATCGCCTGGCCGCCACGGGCCCCCC
ATGGATCCCTACCCGCCTTCTCTACGCTCCCGCTCACGTTCCCAGTCTCCTCCTCGCGGCCCTCGCCCTTATGGC
CGAGGCAGGCCTCCCAGCCGCTCGCGCTACTCGCGCTCTCCATCGCGGTCCATGTCGCCGCGCCCTCGCCACCAC
AACGATAGAAACGACTATGCTCCGCGCCGTCGCAGCCGCAGCCGCAACTACGACTACAATGGCGATGATAGACGA
TATCCTGTGAGTCCTGGACGAGGCTAG
Transcript >OphauG2|7837
ATGGCTCCGCGCTCCCTCTCGCCCTCGCCGCCACGGGGCCGCATGCGCTCTCGCACACGCTCACCATCGCGTCGC
TCAGACGACTCGCGCCGCCGTCGCTACCCGTCGCGCTCTGCTACGCGCTCGCCTTCGCCCGCCATGCGTCGCAAT
GGCCGCCGTGGGAGCGAGTCTCGAAGCCGTAGTCGCAGCCGTGCTTATGCAAGGGATGGAGGAGGCTTCGGGCCT
AGAGAGGCGCCGCCAGTCATGGGAACCAAGATTGTCGTTGAGCGCCTCTCCAAAAACGTGACCGAGTCGCATCTC
CGCGAAATATTTGGCTACTACGGCCCCATTCAAGACCTTGACCTCCCCTTGAACCGCACCTTCGGCACAAACCGC
GGCACCGCATACATCCTGTACGAGCACCGCGAAGACGCCGAAGAGGCCATTGCCAACATGCACGACGGCCAAATC
GACGGCACCGTTATCAACGTGTCCATTGTCCTCCCCCGCCGCATGTTCTCGCCCCCGCCTCCGCTTGCCCGCCGC
GGTGCAAACATTGATCCTCGCGTTCCCTTTAATGGCTCTCGCGGCGGTCGCGGCGGCCGTATGCGCCATAGTCCA
GGCTACGACTATAACGGCCCTCCTCGAGGCCCGAGCCGTCGCTACCCGCCATCGCCTGGCCGCCACGGGCCCCCC
ATGGATCCCTACCCGCCTTCTCTACGCTCCCGCTCACGTTCCCAGTCTCCTCCTCGCGGCCCTCGCCCTTATGGC
CGAGGCAGGCCTCCCAGCCGCTCGCGCTACTCGCGCTCTCCATCGCGGTCCATGTCGCCGCGCCCTCGCCACCAC
AACGATAGAAACGACTATGCTCCGCGCCGTCGCAGCCGCAGCCGCAACTACGACTACAATGGCGATGATAGACGA
TATCCTGTGAGTCCTGGACGAGGCTAG
Gene >OphauG2|7837
ATGGCTCCGCGCTCCCTCTCGCCCTCGCCGCCACGGGGCCGCATGCGCTCTCGCACACGCTCACCATCGCGTCGC
TCAGACGACTCGCGCCGCCGTCGCTACCCGTCGCGCTCTGCTACGCGCTCGCCTTCGCCCGCCATGCGTCGCAAT
GGCCGCCGTGGGAGCGAGTCTCGAAGCCGTAGTCGCAGCCGTGCTTATGCAAGGGATGGAGGAGGCTTCGGGCCT
AGAGAGGCGCCGCCAGTCATGGGAACCAAGGTGAGGCCTTTTTTCCTCGCACATGTATATATATATATATATACA
TATACACACATTGCCGACTTGTTTTGCCTTGTTTGCCTTGTCAGCACTGACGCCGTGGCAGATTGTCGTTGAGCG
CCTCTCCAAAAACGTGACCGAGTCGCATCTCCGCGAAATATTTGGCTACTACGGCCCCATTCAAGACCTTGACCT
CCCCTTGAACCGCACCTGTAAGCCCCAGCTCCTCCTTGCTGCTACTTCTCCCCGCCCTCGACTCCTTCCATGCCA
TGCTAACCACGACAACAAACAGTCGGCACAAACCGCGGCACCGCATACATCCTGTACGAGCACCGCGAAGACGCC
GAAGAGGCCATTGCCAACATGCACGACGGCCAAATCGACGGCACCGTTATCAACGTGTCCATTGTCCTCCCCCGC
CGCATGTTCTCGCCCCCGCCTCCGCTTGCCCGCCGCGGTGCAAACATTGATCCTCGCGTTCCCTTTAATGGCTCT
CGCGGCGGTCGCGGCGGCCGTATGCGCCATAGTCCAGGCTACGACTATAACGGCCCTCCTCGAGGCCCGAGCCGT
CGCTACCCGCCATCGCCTGGCCGCCACGGGCCCCCCATGGATCCCTACCCGCCTTCTCTACGCTCCCGCTCACGT
TCCCAGTCTCCTCCTCGCGGCCCTCGCCCTTATGGCCGAGGCAGGCCTCCCAGCCGCTCGCGCTACTCGCGCTCT
CCATCGCGGTCCATGTCGCCGCGCCCTCGCCACCACAACGATAGAAACGACTATGCTCCGCGCCGTCGCAGCCGC
AGCCGCAACTACGACTACAATGGCGATGATAGACGATATCCTGTGAGTCCTGGACGAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail