Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7832
Gene name
LocationContig_958:2745..6059
Strand-
Gene length (bp)3314
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125) 1.6E-88 112 527

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10449|MU157_SCHPO Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug157 PE=1 SV=1 61 537 1.0E-66
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 554 728 3.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 587 730 7.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 569 748 8.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 538 708 5.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7832
MRLQTTGIVLGLLFSSAAADPGAWLWHNESKAAWSSLPWHMGAPPGEWKNYKFESRIPSTCEPYETYVQRPHEPL
SEGKLKVPFMRPPPECRTFNSSAAEKVVMYMKAHMRDPDLARLFENSFSMALDTTVKWFDPQKNLSFIVTGEIDA
QWMRDTELQLAHLYRLLPWEENLRNLFKSIIKTEARFVTNWTFCSAMQPPPESGLPPILNEDPTHKVVSENMQLI
PNHTVYECKWNVASLASFLRISRKYWEHTKDDSFVTPEWKEAVWRVMDALNIQTRGKMLNEVTQWHFRKRASKPI
APWPRTPEMGAREPYRWGHMIASTYRPSGQMTTFDLNVPANAMISWELRQVGAMAKTLHKAFTDFEWQLLTSTGL
LIDYGVWVNCRTMDGVFSYESNGLTSHYYMDDPMIPSLLGLSYVGFSKRGNWVYKNIKFEMTFARNPYYVRGHNY
IGMVAPPPIHDFAWPMSQLSLVFGGRKSPGIRSRIKKIRDICAAAGVIPAGVHINLANNYTRLWFPASSSYFAQA
ILDVARRKPHLIFKRPKSYRVGDEQAWYLKFAEQEAKEKKLVDKDDKRLEKKRQKEWKKYHKKEKEDMSKYENPR
QKEEFKQRKKYLEEIEERLEKQRKKYKETAEKLKKEEMRRKEKEEKERKEKEKERLERVEWARQKKKEMEEMEKK
RKAREEAEKTPKEREEAEKTPKEREEAEKTPKEREEAEKTPKEREEAEKRPKEKEKGHNEATKYGVDVVDMVKGF
DKRGDNDIEDETEDPDDPMGASITGAIEEEEEDDDDDEEEEGRNSEDSGGVNLQDWYEIADEFKTEPGSQAGGSN
RLMWRDKITAEMQMAAAAAAAAAAA*
Coding >OphauG2|7832
ATGCGCCTGCAAACCACGGGCATCGTGCTTGGCTTGCTTTTCAGCAGTGCCGCCGCAGACCCCGGAGCTTGGCTG
TGGCACAATGAATCCAAGGCGGCTTGGTCGAGTTTGCCGTGGCACATGGGAGCGCCGCCCGGCGAGTGGAAGAAT
TACAAGTTTGAAAGCCGGATCCCGTCGACATGTGAGCCGTACGAGACTTATGTCCAGAGGCCGCATGAGCCTCTC
TCCGAGGGGAAGCTCAAGGTGCCGTTTATGCGACCGCCTCCCGAGTGTCGAACGTTTAACAGTAGCGCTGCCGAG
AAAGTCGTCATGTACATGAAAGCGCACATGAGGGACCCAGACCTGGCCCGACTGTTTGAAAACTCGTTTTCAATG
GCCCTCGACACCACTGTCAAGTGGTTCGATCCGCAAAAGAACCTGTCCTTTATAGTCACGGGCGAAATCGATGCA
CAGTGGATGAGAGACACGGAGCTCCAGCTAGCACATTTATACCGGCTGCTACCCTGGGAGGAGAATCTGCGCAAT
CTTTTCAAGTCCATCATCAAGACCGAGGCGCGCTTTGTAACGAATTGGACGTTTTGCAGTGCTATGCAGCCGCCT
CCAGAGAGCGGCCTCCCTCCAATTTTGAATGAAGATCCAACGCACAAAGTTGTTTCGGAAAACATGCAGCTGATC
CCCAATCACACCGTCTACGAGTGCAAGTGGAACGTGGCCTCGCTTGCGAGTTTCCTGAGAATCTCGCGCAAGTAC
TGGGAACACACCAAAGACGACTCCTTTGTCACGCCTGAATGGAAAGAGGCTGTGTGGAGAGTCATGGATGCCTTG
AATATACAGACGCGAGGCAAGATGCTCAATGAAGTGACGCAGTGGCACTTTAGAAAACGAGCAAGCAAACCCATT
GCGCCGTGGCCAAGAACTCCTGAGATGGGGGCTCGCGAGCCGTATCGATGGGGACACATGATTGCGTCGACGTAT
CGCCCTTCAGGGCAGATGACTACCTTTGATCTCAATGTCCCAGCAAACGCCATGATCTCGTGGGAGCTGCGACAG
GTGGGCGCCATGGCCAAAACGCTGCACAAGGCCTTTACCGACTTTGAATGGCAGCTCCTCACCTCGACCGGACTG
CTGATTGACTATGGCGTTTGGGTCAACTGCCGCACCATGGACGGCGTCTTTTCCTACGAGTCGAATGGGCTGACG
TCGCATTACTACATGGATGATCCCATGATTCCTAGTCTCCTGGGCCTGTCCTATGTCGGGTTTTCGAAACGGGGG
AACTGGGTGTATAAGAATATAAAGTTTGAAATGACGTTTGCTAGGAATCCTTACTATGTTCGCGGCCACAACTAC
ATTGGCATGGTTGCTCCGCCCCCCATCCACGACTTTGCCTGGCCCATGTCGCAGCTCTCGCTCGTCTTTGGCGGA
CGCAAGTCGCCTGGCATCAGATCGCGCATCAAAAAGATTCGCGACATTTGCGCAGCAGCGGGCGTGATACCGGCA
GGGGTGCACATCAACTTGGCCAACAACTACACGCGACTCTGGTTCCCCGCGTCGAGCAGCTACTTTGCGCAAGCG
ATTCTCGACGTGGCCAGGCGCAAGCCACATTTAATTTTCAAGAGGCCCAAGAGCTACCGAGTAGGCGACGAGCAG
GCGTGGTACCTCAAGTTTGCGGAGCAAGAGGCCAAGGAGAAAAAGTTGGTCGACAAGGATGACAAGAGACTGGAG
AAGAAGCGGCAAAAGGAATGGAAAAAGTACCACAAGAAGGAGAAGGAAGACATGTCCAAGTATGAAAATCCAAGG
CAGAAGGAGGAATTTAAGCAGCGGAAGAAGTATCTAGAAGAGATTGAGGAGAGGCTAGAGAAGCAAAGGAAAAAG
TACAAGGAGACGGCTGAGAAGTTGAAGAAGGAGGAGATGCGGCGAAAGGAGAAGGAGGAAAAGGAGAGGAAGGAA
AAGGAAAAGGAGAGGCTGGAAAGGGTCGAGTGGGCACGGCAGAAGAAGAAGGAGATGGAGGAGATGGAGAAGAAA
CGCAAGGCCCGGGAAGAAGCAGAGAAGACGCCAAAAGAAAGGGAAGAAGCAGAAAAGACTCCAAAAGAAAGGGAA
GAAGCAGAAAAGACGCCAAAAGAAAGGGAAGAAGCAGAAAAGACTCCAAAAGAAAGGGAAGAAGCAGAAAAGAGG
CCAAAAGAAAAGGAAAAGGGCCACAACGAGGCAACCAAGTACGGGGTGGACGTGGTCGACATGGTCAAGGGATTC
GACAAGCGTGGCGACAACGACATTGAAGACGAGACCGAAGACCCCGACGACCCAATGGGGGCTTCCATCACTGGA
GCAATCGAGGAGGAGGAGGAGGACGACGACGATGATGAAGAGGAAGAGGGCCGGAATAGCGAGGATTCGGGGGGC
GTCAATCTACAAGACTGGTACGAAATTGCCGACGAGTTCAAGACGGAGCCAGGGTCACAGGCAGGGGGCTCCAAC
AGACTGATGTGGAGGGACAAGATTACGGCTGAGATGCAGATGGCTGCTGCTGCTGCTGCTGCGGCGGCGGCAGCG
TGA
Transcript >OphauG2|7832
ATGCGCCTGCAAACCACGGGCATCGTGCTTGGCTTGCTTTTCAGCAGTGCCGCCGCAGACCCCGGAGCTTGGCTG
TGGCACAATGAATCCAAGGCGGCTTGGTCGAGTTTGCCGTGGCACATGGGAGCGCCGCCCGGCGAGTGGAAGAAT
TACAAGTTTGAAAGCCGGATCCCGTCGACATGTGAGCCGTACGAGACTTATGTCCAGAGGCCGCATGAGCCTCTC
TCCGAGGGGAAGCTCAAGGTGCCGTTTATGCGACCGCCTCCCGAGTGTCGAACGTTTAACAGTAGCGCTGCCGAG
AAAGTCGTCATGTACATGAAAGCGCACATGAGGGACCCAGACCTGGCCCGACTGTTTGAAAACTCGTTTTCAATG
GCCCTCGACACCACTGTCAAGTGGTTCGATCCGCAAAAGAACCTGTCCTTTATAGTCACGGGCGAAATCGATGCA
CAGTGGATGAGAGACACGGAGCTCCAGCTAGCACATTTATACCGGCTGCTACCCTGGGAGGAGAATCTGCGCAAT
CTTTTCAAGTCCATCATCAAGACCGAGGCGCGCTTTGTAACGAATTGGACGTTTTGCAGTGCTATGCAGCCGCCT
CCAGAGAGCGGCCTCCCTCCAATTTTGAATGAAGATCCAACGCACAAAGTTGTTTCGGAAAACATGCAGCTGATC
CCCAATCACACCGTCTACGAGTGCAAGTGGAACGTGGCCTCGCTTGCGAGTTTCCTGAGAATCTCGCGCAAGTAC
TGGGAACACACCAAAGACGACTCCTTTGTCACGCCTGAATGGAAAGAGGCTGTGTGGAGAGTCATGGATGCCTTG
AATATACAGACGCGAGGCAAGATGCTCAATGAAGTGACGCAGTGGCACTTTAGAAAACGAGCAAGCAAACCCATT
GCGCCGTGGCCAAGAACTCCTGAGATGGGGGCTCGCGAGCCGTATCGATGGGGACACATGATTGCGTCGACGTAT
CGCCCTTCAGGGCAGATGACTACCTTTGATCTCAATGTCCCAGCAAACGCCATGATCTCGTGGGAGCTGCGACAG
GTGGGCGCCATGGCCAAAACGCTGCACAAGGCCTTTACCGACTTTGAATGGCAGCTCCTCACCTCGACCGGACTG
CTGATTGACTATGGCGTTTGGGTCAACTGCCGCACCATGGACGGCGTCTTTTCCTACGAGTCGAATGGGCTGACG
TCGCATTACTACATGGATGATCCCATGATTCCTAGTCTCCTGGGCCTGTCCTATGTCGGGTTTTCGAAACGGGGG
AACTGGGTGTATAAGAATATAAAGTTTGAAATGACGTTTGCTAGGAATCCTTACTATGTTCGCGGCCACAACTAC
ATTGGCATGGTTGCTCCGCCCCCCATCCACGACTTTGCCTGGCCCATGTCGCAGCTCTCGCTCGTCTTTGGCGGA
CGCAAGTCGCCTGGCATCAGATCGCGCATCAAAAAGATTCGCGACATTTGCGCAGCAGCGGGCGTGATACCGGCA
GGGGTGCACATCAACTTGGCCAACAACTACACGCGACTCTGGTTCCCCGCGTCGAGCAGCTACTTTGCGCAAGCG
ATTCTCGACGTGGCCAGGCGCAAGCCACATTTAATTTTCAAGAGGCCCAAGAGCTACCGAGTAGGCGACGAGCAG
GCGTGGTACCTCAAGTTTGCGGAGCAAGAGGCCAAGGAGAAAAAGTTGGTCGACAAGGATGACAAGAGACTGGAG
AAGAAGCGGCAAAAGGAATGGAAAAAGTACCACAAGAAGGAGAAGGAAGACATGTCCAAGTATGAAAATCCAAGG
CAGAAGGAGGAATTTAAGCAGCGGAAGAAGTATCTAGAAGAGATTGAGGAGAGGCTAGAGAAGCAAAGGAAAAAG
TACAAGGAGACGGCTGAGAAGTTGAAGAAGGAGGAGATGCGGCGAAAGGAGAAGGAGGAAAAGGAGAGGAAGGAA
AAGGAAAAGGAGAGGCTGGAAAGGGTCGAGTGGGCACGGCAGAAGAAGAAGGAGATGGAGGAGATGGAGAAGAAA
CGCAAGGCCCGGGAAGAAGCAGAGAAGACGCCAAAAGAAAGGGAAGAAGCAGAAAAGACTCCAAAAGAAAGGGAA
GAAGCAGAAAAGACGCCAAAAGAAAGGGAAGAAGCAGAAAAGACTCCAAAAGAAAGGGAAGAAGCAGAAAAGAGG
CCAAAAGAAAAGGAAAAGGGCCACAACGAGGCAACCAAGTACGGGGTGGACGTGGTCGACATGGTCAAGGGATTC
GACAAGCGTGGCGACAACGACATTGAAGACGAGACCGAAGACCCCGACGACCCAATGGGGGCTTCCATCACTGGA
GCAATCGAGGAGGAGGAGGAGGACGACGACGATGATGAAGAGGAAGAGGGCCGGAATAGCGAGGATTCGGGGGGC
GTCAATCTACAAGACTGGTACGAAATTGCCGACGAGTTCAAGACGGAGCCAGGGTCACAGGCAGGGGGCTCCAAC
AGACTGATGTGGAGGGACAAGATTACGGCTGAGATGCAGATGGCTGCTGCTGCTGCTGCTGCGGCGGCGGCAGCG
TGA
Gene >OphauG2|7832
ATGCGCCTGCAAACCACGGGCATCGTGCTTGGCTTGCTTTTCAGCAGTGCCGCCGCAGACCCCGGAGCTTGGCTG
TGGCACAATGAATCCAAGGCGGCTTGGTCGAGTTTGCCGTGGCACATGGGAGCGCCGCCCGGCGAGTGGAAGAAT
TACAAGTTTGAAAGCCGGATCCCGTCGACATGTGAGCCGTACGAGACTTATGTCCAGAGGCCGCATGAGCCTCTC
TCCGAGGGGAAGCTCAAGGTGCCGTTTATGCGACCGCCTCCCGAGTGTCGAACGTTTAACAGTAGCGCTGCCGAG
GTCTTTTTCTCTTCTCCTGTCTTCTTTTCTCGCTTAGGAGTCAGTGGCTGACTGCAAGAGTAGAAAGTCGTCATG
TACATGAAAGCGCACATGAGGGACCCAGACCTGGCCCGACTGTTTGAAAACTCGTTTTCAATGGCCCTCGACACC
ACTGTCAAGTGGTTCGATCCGCAAAAGAACCTGTCCTTTATAGTCACGGGCGTAAGTCCCCCACCCACTGTCAAG
AATTTGTACAGGTACTGACTAAAGGCGTTTTAGGAAATCGAGTAAGTTTGAAATGTCGAGTTGCTCGCACAGAGA
CGCGTGATGCTGAGAAGCGCAGTGCACAGTGGATGAGAGACACGGAGCTCCAGCTAGCACATTTATACCGGCTGC
TACCCTGGGAGGAGAATCTGCGCAATCTTTTCAAGTCCATCATCAAGACCGAGGCGCGCTTTGTAACGAATTGGA
CGTTTTGCAGTGAGTTGGGCTGTGAGGGGTTTGGAGACTGGCTGTTGCTGACCGACTTTTTTCAAGGTGCTATGC
AGCCGCCTCCAGAGAGCGGCCTCCCTCCAATTTTGAATGTGAGTTTTTTTTTTAAAAAAAAAGATTCACTTGACG
AGGAAAGAATGAAGGCTAATGTCGCTCGCTGGGGTGTAGGAAGATCCAACGCACAAAGTTGTTTCGGAAAACATG
CAGTACGTAGGCTCGAGATGTGCTATATGTTTTTGAGTAGTCTTTTTTTTTAGTTTTGGTTGGCTTACAACAAGT
GCAGGCTGATCCCCAATCACACCGTCTACGAGTGCAAGGTAGGTCCAACAAGGAAGCAAATCAGCGCGTGAAGGA
TTCATCGCTGATAGGCAAACAGTGGAACGTGGCCTCGCTTGCGAGTTTCCTGAGAATCTCGCGCAAGTACTGGGA
ACACACCAAAGACGACTCCTTTGTCACGCCTGAATGTAAGCGCGCACGGCTTGAAGAAACATGATTCACAGTCTG
ACTGAGGCGGCGGGCAGGGAAAGAGGCTGTGTGGAGAGTCATGGATGCCTTGAATATACAGACGCGAGGCAAGAT
GCTCAATGAAGTGACGCAGTGGCACTTTAGAAAACGAGCAAGCAAACCCATTGCGCCGTGGCCAAGAACTCCTGA
GATGGGGGCTCGCGAGCCGTATCGATGGGGACACATGATTGCGTCGACGTATCGCCCTTCAGGGCAGATGACTAC
CTTTGGTGAGCAAAGTTTGATCTTGGTCTGCATTGGTTCTAGATGGCAGTTTTGGATATGAGTCCCAGACATCAG
TCCAGTCATCAATCCCAGACATCAGTCCTTGTCATCAATTCTCGTCTAACGCGCAGGACGCGACAGATCTCAATG
TCCCAGCAAACGCCATGATCTCGTGGGAGCTGCGACAGGTGGGCGCCATGGCCAAAACGCTGCACAAGGCCTTTA
CCGACTTTGAATGGCAGCTCCTCACCTCGACCGGACTGCTGATTGACTATGGCGTTTGGGTCAACTGCCGCACCA
TGGACGGCGTCTTTTCCTACGAGTCGAATGGGCTGACGTCGCATTACTACATGGATGATCCCATGATTCCTAGTC
TCCTGGGCCTGTCCTATGTCGGGTTTTCGAAACGGGGGAACTGGGTGTATAAGAATATAAAGTTTGAAATGACGT
TTGCTAGGAATCCTTACTATGTTCGCGGCCACAACTACATTGGCATGGTGTAAGTCTAGCCCAGGGGAAGCAAGC
AAGAAAGGAAGCGAGAGCCAAAAGCATCAACAAGAGATGTGAAAAAAAAAAAAAAAAATTCAAAACAGACAAGAA
AAAGGCTGACTCGCCCCTCTAGTGCTCCGCCCCCCATCCACGACTTTGCCTGGCCCATGTCGCAGCTCTCGCTCG
TCTTTGGCGGACGCAAGTCGCCTGGCATCAGATCGCGCATCAAAAAGATTCGCGACATTTGCGCAGCAGCGGGCG
TGATACCGGCAGGGGTGCACATCAACTTGGCCAACAACTACACGCGACTCTGGTTCCCCGCGTCGAGCAGCTACT
TTGCGCAAGCGATTCTCGACGTGGCCAGGCGCAAGCCACATTTAATTTTCAAGAGGCCCAAGAGCTACCGAGTAG
GCGACGAGCAGGCGTGGTACCTCAAGTTTGCGGAGCAAGAGGCCAAGGAGAAAAAGTTGGTCGACAAGGATGACA
AGAGACTGGAGAAGAAGCGGCAAAAGGAATGGAAAAAGTACCACAAGAAGGAGAAGGAAGACATGTCCAAGTATG
AAAATCCAAGGCAGAAGGAGGAATTTAAGCAGCGGAAGAAGTATCTAGAAGAGATTGAGGAGAGGCTAGAGAAGC
AAAGGAAAAAGTACAAGGAGACGGCTGAGAAGTTGAAGAAGGAGGAGATGCGGCGAAAGGAGAAGGAGGAAAAGG
AGAGGAAGGAAAAGGAAAAGGAGAGGCTGGAAAGGGTCGAGTGGGCACGGCAGAAGAAGAAGGAGATGGAGGAGA
TGGAGAAGAAACGCAAGGCCCGGGAAGAAGCAGAGAAGACGCCAAAAGAAAGGGAAGAAGCAGAAAAGACTCCAA
AAGAAAGGGAAGAAGCAGAAAAGACGCCAAAAGAAAGGGAAGAAGCAGAAAAGACTCCAAAAGAAAGGGAAGAAG
CAGAAAAGAGGCCAAAAGAAAAGGAAAAGGGCCACAACGAGGCAACCAAGTACGGGGTGGACGTGGTCGACATGG
TCAAGGGATTCGACAAGCGTGGCGACAACGACATTGAAGACGAGACCGAAGACCCCGACGACCCAATGGGGGCTT
CCATCACTGGAGCAATCGAGGAGGAGGAGGAGGACGACGACGATGATGAAGAGGAAGAGGGCCGGAATAGCGAGG
ATTCGGGGGGCGTCAATCTACAAGACTGGTACGAAATTGCCGACGAGTTCAAGACGGAGCCAGGGTCACAGGCAG
GGGGCTCCAACAGACTGATGTGGAGGGACAAGATTACGGCTGAGATGCAGATGGCTGCTGCTGCTGCTGCTGCGG
CGGCGGCAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail