Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7822
Gene name
LocationContig_954:3270..3802
Strand-
Gene length (bp)532
Transcript length (bp)228
Coding sequence length (bp)228
Protein length (aa) 76

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08520 DUF1748 Fungal protein of unknown function (DUF1748) 6.1E-33 3 73

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2V2P4|YI156_YEAST Uncharacterized protein YIL156W-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL156W-B PE=3 SV=1 2 74 5.0E-16
sp|Q10167|YAUE_SCHPO Uncharacterized protein C26A3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26A3.14c PE=4 SV=1 3 73 3.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5775
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7822 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00069
Ophiocordyceps camponoti-rufipedis Ophun1|631
Ophiocordyceps kimflemingae Ophio5|3192
Ophiocordyceps subramaniannii Hirsu2|9541

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7822
MVVGRLTHYAFDAVLLSAFLAGMKRSTGLTFKTDRVAGDNNEVSKWIDKYLGVGEWVMDQSVAIAGSSGFFERKR
*
Coding >OphauG2|7822
ATGGTGGTTGGACGATTGACGCACTATGCTTTCGACGCCGTTCTCTTATCGGCATTTCTCGCCGGCATGAAGCGC
TCCACTGGCTTGACTTTCAAGACGGACCGTGTTGCGGGAGATAACAACGAAGTCTCAAAGTGGATCGACAAGTAT
CTTGGTGTGGGCGAATGGGTCATGGACCAGTCTGTAGCCATTGCTGGCTCGAGTGGCTTTTTTGAGCGCAAGCGG
TGA
Transcript >OphauG2|7822
ATGGTGGTTGGACGATTGACGCACTATGCTTTCGACGCCGTTCTCTTATCGGCATTTCTCGCCGGCATGAAGCGC
TCCACTGGCTTGACTTTCAAGACGGACCGTGTTGCGGGAGATAACAACGAAGTCTCAAAGTGGATCGACAAGTAT
CTTGGTGTGGGCGAATGGGTCATGGACCAGTCTGTAGCCATTGCTGGCTCGAGTGGCTTTTTTGAGCGCAAGCGG
TGA
Gene >OphauG2|7822
ATGGTGGTAAGCGCACAATCCCTCTGCCGCGAACCCCCCTCAGCCTCGGAATTGTCCCAGAGGCCTCGCGAGTGC
TCCATGCAATAGGCCTCTTCTAAGACTTTGCTCCCAGCTCCTCAATATACTGACGCTGGGCCTGTGGTCAAAGGT
TGGACGATTGACGCACTATGCTTTCGACGCCGTTCTCTGTACGTTGCCACGCATTCTGCCAGTCCGTCTCTGTCT
CCTCCCCCTGCTGACTTTTTGCCAGTATCGGCATTTCTCGCCGGCATGAAGCGCTCCACTGGCTTGACGTGAGTC
GCCCCCGTGCTTCTAGACGCTTGTGTGCCCAAATCTTGTTGATAGTATGCAGCCAGCTAACTATTCTCCCGCCGA
GGGACGCCTAAGACCCAGTTTCAAGACGGACCGTGTTGCGGGAGATAACAACGAAGTCTCAAAGTGGATCGACAA
GTATCTTGGTGTGGGCGAATGGGTCATGGACCAGTCTGTAGCCATTGCTGGCTCGAGTGGCTTTTTTGAGCGCAA
GCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail