Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7814
Gene name
LocationContig_951:6505..6778
Strand-
Gene length (bp)273
Transcript length (bp)273
Coding sequence length (bp)273
Protein length (aa) 91

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 2.2E-11 37 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 40 90 9.0E-07

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 70 89 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7814
MAPAPAIASLSAALAYSTRPGAIDLKRVHAARLVAIARAEFWPIINAGMRFWPLVSLLNFTLVKTVHARNLVGAL
AGVAWGVYMSLMAAR*
Coding >OphauG2|7814
ATGGCTCCTGCGCCCGCAATCGCCAGCCTCTCGGCCGCCCTGGCCTACTCTACCCGCCCAGGCGCCATCGACTTG
AAGCGAGTCCATGCTGCTCGCCTCGTCGCCATTGCAAGGGCCGAGTTTTGGCCCATCATCAATGCTGGCATGCGC
TTTTGGCCTCTAGTCAGTCTGCTCAACTTTACTCTTGTCAAGACTGTCCATGCCCGCAACTTGGTAGGCGCCCTC
GCCGGTGTTGCCTGGGGCGTCTACATGAGCCTCATGGCCGCCCGCTGA
Transcript >OphauG2|7814
ATGGCTCCTGCGCCCGCAATCGCCAGCCTCTCGGCCGCCCTGGCCTACTCTACCCGCCCAGGCGCCATCGACTTG
AAGCGAGTCCATGCTGCTCGCCTCGTCGCCATTGCAAGGGCCGAGTTTTGGCCCATCATCAATGCTGGCATGCGC
TTTTGGCCTCTAGTCAGTCTGCTCAACTTTACTCTTGTCAAGACTGTCCATGCCCGCAACTTGGTAGGCGCCCTC
GCCGGTGTTGCCTGGGGCGTCTACATGAGCCTCATGGCCGCCCGCTGA
Gene >OphauG2|7814
ATGGCTCCTGCGCCCGCAATCGCCAGCCTCTCGGCCGCCCTGGCCTACTCTACCCGCCCAGGCGCCATCGACTTG
AAGCGAGTCCATGCTGCTCGCCTCGTCGCCATTGCAAGGGCCGAGTTTTGGCCCATCATCAATGCTGGCATGCGC
TTTTGGCCTCTAGTCAGTCTGCTCAACTTTACTCTTGTCAAGACTGTCCATGCCCGCAACTTGGTAGGCGCCCTC
GCCGGTGTTGCCTGGGGCGTCTACATGAGCCTCATGGCCGCCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail