Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7812
Gene name
LocationContig_951:3482..3931
Strand-
Gene length (bp)449
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07876 Dabb Stress responsive A/B Barrel Domain 9.3E-12 15 104

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6699
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7812 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00875
Ophiocordyceps kimflemingae Ophio5|6542
Ophiocordyceps subramaniannii Hirsu2|6208

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7812
MSASPASHLPVHERIQRVTMFKLPDPAHQQQLIERYKDLVANNSRHGKPYILSLVVGPADEHPRSQGYTVVSRTE
FASRDDVLFYDQECPAHQKLIAFIKTLVVEDIVTVVFKPQLVAP*
Coding >OphauG2|7812
ATGTCTGCCTCTCCGGCCTCCCACTTGCCAGTACACGAGCGCATTCAGCGCGTCACCATGTTCAAGCTGCCCGAC
CCCGCCCATCAGCAACAGCTCATTGAGCGATACAAGGACCTTGTCGCCAACAATAGCAGGCATGGCAAACCCTAC
ATTCTCTCCCTTGTCGTCGGCCCGGCAGATGAACATCCCCGCTCCCAAGGCTACACTGTCGTCTCGCGCACCGAG
TTTGCCTCACGCGACGACGTGCTCTTCTATGATCAAGAGTGTCCTGCCCACCAGAAGCTCATTGCTTTCATCAAG
ACGCTTGTAGTCGAAGACATTGTCACCGTCGTTTTCAAGCCCCAGCTTGTGGCGCCGTGA
Transcript >OphauG2|7812
ATGTCTGCCTCTCCGGCCTCCCACTTGCCAGTACACGAGCGCATTCAGCGCGTCACCATGTTCAAGCTGCCCGAC
CCCGCCCATCAGCAACAGCTCATTGAGCGATACAAGGACCTTGTCGCCAACAATAGCAGGCATGGCAAACCCTAC
ATTCTCTCCCTTGTCGTCGGCCCGGCAGATGAACATCCCCGCTCCCAAGGCTACACTGTCGTCTCGCGCACCGAG
TTTGCCTCACGCGACGACGTGCTCTTCTATGATCAAGAGTGTCCTGCCCACCAGAAGCTCATTGCTTTCATCAAG
ACGCTTGTAGTCGAAGACATTGTCACCGTCGTTTTCAAGCCCCAGCTTGTGGCGCCGTGA
Gene >OphauG2|7812
ATGTCTGCCTCTCCGGCCTCCCACTTGCCAGTACACGAGCGCATTCAGCGCGTCACCATGTTCAAGCTGCCCGAC
CCCGCCCATCAGCAACAGCTCATTGAGCGATACAAGGACCTTGTCGCCAACAATAGCAGGGTAAAAAAGAAATCT
CAATTGTTTTTATCGCTCCATGTCCCAATTTGACAATTGACGCGACTGGCTGACTCTGGAAAAAAATCAAAAAGC
ATGGCAAACCCTACATTCTCTCCCTTGTCGTCGGCCCGGCAGATGAACATCCCCGCTCCCAAGGCTACACTGTCG
TCTCGCGCACCGAGTTTGCCTCACGCGACGACGTGCTCTTCTATGATCAAGAGTGTCCTGCCCACCAGAAGCTCA
TTGCTTTCATCAAGACGCTTGTAGTCGAAGACATTGTCACCGTCGTTTTCAAGCCCCAGCTTGTGGCGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail