Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7799
Gene name
LocationContig_95:11587..12911
Strand+
Gene length (bp)1324
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01987 AIM24 Mitochondrial biogenesis AIM24 7.0E-49 62 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C9SDH0|AIM24_VERA1 Altered inheritance of mitochondria protein 24, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=AIM24 PE=3 SV=1 1 385 0.0E+00
sp|C8V7C7|AIM24_EMENI Altered inheritance of mitochondria protein 24, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aim24 PE=3 SV=1 2 375 3.0E-115
sp|C5GW39|AIM24_AJEDR Altered inheritance of mitochondria protein 24, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=aim24 PE=3 SV=1 28 375 5.0E-114
sp|C5JD82|AIM24_AJEDS Altered inheritance of mitochondria protein 24, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=aim24 PE=3 SV=1 28 375 2.0E-113
sp|C5FL48|AIM24_ARTOC Altered inheritance of mitochondria protein 24, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=AIM24 PE=3 SV=1 21 375 3.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C9SDH0|AIM24_VERA1 Altered inheritance of mitochondria protein 24, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=AIM24 PE=3 SV=1 1 385 0.0E+00
sp|C8V7C7|AIM24_EMENI Altered inheritance of mitochondria protein 24, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aim24 PE=3 SV=1 2 375 3.0E-115
sp|C5GW39|AIM24_AJEDR Altered inheritance of mitochondria protein 24, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=aim24 PE=3 SV=1 28 375 5.0E-114
sp|C5JD82|AIM24_AJEDS Altered inheritance of mitochondria protein 24, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=aim24 PE=3 SV=1 28 375 2.0E-113
sp|C5FL48|AIM24_ARTOC Altered inheritance of mitochondria protein 24, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=AIM24 PE=3 SV=1 21 375 3.0E-111
sp|B6QEP5|AIM24_TALMQ Altered inheritance of mitochondria protein 24, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aim24 PE=3 SV=1 61 385 2.0E-110
sp|B8MDC1|AIM24_TALSN Altered inheritance of mitochondria protein 24, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=aim24 PE=3 SV=1 61 378 2.0E-107
sp|B8N219|AIM24_ASPFN Altered inheritance of mitochondria protein 24, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aim24 PE=3 SV=1 27 375 2.0E-105
sp|C5PFU3|AIM24_COCP7 Altered inheritance of mitochondria protein 24, mitochondrial OS=Coccidioides posadasii (strain C735) GN=aim24 PE=3 SV=1 6 375 8.0E-103
sp|B6HP17|AIM24_PENRW Altered inheritance of mitochondria protein 24, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=aim24 PE=3 SV=1 25 376 2.0E-102
sp|Q0CSL5|AIM24_ASPTN Altered inheritance of mitochondria protein 24, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aim24 PE=3 SV=1 14 375 6.0E-96
sp|Q6C749|AIM24_YARLI Altered inheritance of mitochondria protein 24, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AIM24 PE=3 SV=1 61 324 4.0E-43
sp|A3LZY1|AIM24_PICST Altered inheritance of mitochondria protein 24, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=AIM24 PE=3 SV=1 54 330 5.0E-25
sp|C4QXH2|AIM24_PICPG Altered inheritance of mitochondria protein 24, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=AIM24 PE=3 SV=1 19 305 2.0E-20
sp|Q6BKX6|AIM24_DEBHA Altered inheritance of mitochondria protein 24, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM24 PE=3 SV=2 19 305 9.0E-19
sp|A5DJK0|AIM24_PICGU Altered inheritance of mitochondria protein 24, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM24 PE=3 SV=2 54 344 2.0E-17
sp|C4Y7Q2|AIM24_CLAL4 Altered inheritance of mitochondria protein 24, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM24 PE=3 SV=1 61 227 4.0E-16
sp|B9WD86|AIM24_CANDC Altered inheritance of mitochondria protein 24, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=AIM24 PE=3 SV=1 82 305 7.0E-14
sp|C5DE09|AIM24_LACTC Altered inheritance of mitochondria protein 24, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=aim24 PE=3 SV=1 17 384 2.0E-11
sp|C4YPQ0|AIM24_CANAW Altered inheritance of mitochondria protein 24, mitochondrial OS=Candida albicans (strain WO-1) GN=AIM24 PE=3 SV=1 15 305 1.0E-10
sp|Q59L25|AIM24_CANAL Altered inheritance of mitochondria protein 24, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AIM24 PE=3 SV=1 15 305 5.0E-10
sp|C5M9N0|AIM24_CANTT Altered inheritance of mitochondria protein 24, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=AIM24 PE=3 SV=1 82 246 2.0E-09
sp|C5DYJ0|AIM24_ZYGRC Altered inheritance of mitochondria protein 24, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM24 PE=3 SV=1 51 385 4.0E-08
sp|Q6CPA5|AIM24_KLULA Altered inheritance of mitochondria protein 24, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM24 PE=3 SV=1 54 302 6.0E-08
sp|A7TM98|AIM24_VANPO Altered inheritance of mitochondria protein 24, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM24 PE=3 SV=1 39 302 3.0E-07
sp|P47127|AIM24_YEAST Altered inheritance of mitochondria protein 24, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM24 PE=1 SV=1 57 375 5.0E-07
sp|C8ZBM7|AIM24_YEAS8 Altered inheritance of mitochondria protein 24, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM24 PE=3 SV=1 57 375 5.0E-07
sp|B3LQG6|AIM24_YEAS1 Altered inheritance of mitochondria protein 24, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM24 PE=3 SV=1 57 375 5.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7799 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1840
Ophiocordyceps camponoti-floridani Ophcf2|03183
Ophiocordyceps camponoti-rufipedis Ophun1|3201
Ophiocordyceps kimflemingae Ophio5|419
Ophiocordyceps subramaniannii Hirsu2|3793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7799
MRAQLPLTQCMRRPRPAQLKSSTCRLCRNIHISATPSTDAPKSSDAFGPSDGTASALADARFEVLGSPYSLLSVT
LSASQKLYTRRGTLVAVAGKPDNAQSTLSLLNPLTRAIFGVPFLYQRISATTPMTALISTKSPTTSFTVIRLDGT
TDWIISQRNALLAWTGYTLKLSSRVENRLSLAHWGSTYLTGRGLAAVSAPGQIYQLTLSEGDEFVAHPGSVVAYA
VSRNPPQPFRFKSSSLRLQVPSLKSWIPETDFLKNMRQTETYKFVARLLFRLRTMARRTIWGDRLFLHFKGPTTL
LMSSRGVRVADVLSPEQVNEVADAPAGVTPRAVELPDTAKTSLDQAQAPAIPLSEQPPSALHVASVRRDGKVTFE
DQKDLKEFVR*
Coding >OphauG2|7799
ATGCGAGCCCAGCTGCCGCTCACCCAATGTATGCGGCGCCCGCGGCCAGCGCAGCTCAAGAGCTCCACATGTCGG
CTCTGTCGTAACATCCACATCAGCGCGACACCCAGCACCGATGCTCCCAAGTCAAGCGACGCTTTTGGACCCTCT
GATGGCACGGCGTCAGCTCTTGCAGATGCCCGTTTCGAAGTGCTCGGGTCGCCCTACTCACTCCTCTCCGTCACC
TTGTCGGCGTCTCAAAAGCTTTATACCCGCCGAGGCACGCTGGTTGCTGTTGCAGGAAAGCCCGACAATGCTCAG
TCGACCTTGTCATTGCTGAACCCCTTGACAAGGGCAATCTTTGGCGTGCCATTTCTTTATCAGCGCATATCCGCC
ACCACGCCCATGACAGCCCTAATTTCTACAAAGTCACCAACAACCAGCTTCACCGTTATTCGTCTCGACGGCACC
ACTGATTGGATCATATCGCAGCGCAACGCACTGCTGGCCTGGACTGGATATACTTTGAAGCTCTCGTCTCGTGTT
GAAAATCGACTGTCGCTAGCCCATTGGGGCAGCACCTACCTAACAGGGCGTGGGCTTGCCGCTGTGTCGGCGCCG
GGTCAGATATACCAGCTCACCCTCTCCGAAGGGGACGAGTTTGTGGCGCATCCCGGCAGTGTCGTGGCATATGCA
GTGTCGAGGAATCCCCCGCAGCCCTTTAGATTCAAGAGCTCCAGCCTCAGGCTTCAGGTCCCGTCGCTGAAGTCT
TGGATTCCCGAAACCGACTTCTTGAAGAACATGCGGCAAACCGAGACGTACAAATTTGTCGCCCGCCTACTCTTT
CGTCTCCGGACAATGGCGCGACGCACCATTTGGGGCGACCGTCTGTTTTTACATTTCAAAGGCCCAACCACACTG
CTCATGTCGAGTCGTGGTGTGCGCGTGGCCGATGTGCTCTCCCCGGAACAAGTCAATGAAGTAGCCGATGCTCCT
GCTGGAGTAACACCCAGGGCTGTTGAGCTACCTGATACTGCAAAGACGTCGTTGGACCAAGCGCAAGCTCCTGCT
ATACCATTGAGCGAACAGCCTCCTAGCGCTCTGCACGTGGCGTCAGTTCGAAGAGACGGAAAAGTGACTTTTGAG
GACCAAAAAGACCTCAAGGAATTTGTGCGTTGA
Transcript >OphauG2|7799
ATGCGAGCCCAGCTGCCGCTCACCCAATGTATGCGGCGCCCGCGGCCAGCGCAGCTCAAGAGCTCCACATGTCGG
CTCTGTCGTAACATCCACATCAGCGCGACACCCAGCACCGATGCTCCCAAGTCAAGCGACGCTTTTGGACCCTCT
GATGGCACGGCGTCAGCTCTTGCAGATGCCCGTTTCGAAGTGCTCGGGTCGCCCTACTCACTCCTCTCCGTCACC
TTGTCGGCGTCTCAAAAGCTTTATACCCGCCGAGGCACGCTGGTTGCTGTTGCAGGAAAGCCCGACAATGCTCAG
TCGACCTTGTCATTGCTGAACCCCTTGACAAGGGCAATCTTTGGCGTGCCATTTCTTTATCAGCGCATATCCGCC
ACCACGCCCATGACAGCCCTAATTTCTACAAAGTCACCAACAACCAGCTTCACCGTTATTCGTCTCGACGGCACC
ACTGATTGGATCATATCGCAGCGCAACGCACTGCTGGCCTGGACTGGATATACTTTGAAGCTCTCGTCTCGTGTT
GAAAATCGACTGTCGCTAGCCCATTGGGGCAGCACCTACCTAACAGGGCGTGGGCTTGCCGCTGTGTCGGCGCCG
GGTCAGATATACCAGCTCACCCTCTCCGAAGGGGACGAGTTTGTGGCGCATCCCGGCAGTGTCGTGGCATATGCA
GTGTCGAGGAATCCCCCGCAGCCCTTTAGATTCAAGAGCTCCAGCCTCAGGCTTCAGGTCCCGTCGCTGAAGTCT
TGGATTCCCGAAACCGACTTCTTGAAGAACATGCGGCAAACCGAGACGTACAAATTTGTCGCCCGCCTACTCTTT
CGTCTCCGGACAATGGCGCGACGCACCATTTGGGGCGACCGTCTGTTTTTACATTTCAAAGGCCCAACCACACTG
CTCATGTCGAGTCGTGGTGTGCGCGTGGCCGATGTGCTCTCCCCGGAACAAGTCAATGAAGTAGCCGATGCTCCT
GCTGGAGTAACACCCAGGGCTGTTGAGCTACCTGATACTGCAAAGACGTCGTTGGACCAAGCGCAAGCTCCTGCT
ATACCATTGAGCGAACAGCCTCCTAGCGCTCTGCACGTGGCGTCAGTTCGAAGAGACGGAAAAGTGACTTTTGAG
GACCAAAAAGACCTCAAGGAATTTGTGCGTTGA
Gene >OphauG2|7799
ATGCGAGCCCAGCTGCCGCTCACCCAATGTATGCGGCGCCCGCGGCCAGCGCAGCTCAAGAGCTCCACATGTCGG
CTCTGTCGTAACATCCACATCAGCGCGACACCCAGCACCGATGCTCCCAAGTCAAGCGACGCTTTTGGACCCTCT
GATGGCACGGCGTCAGCTCTTGCAGGTGCGCAGTCATGCTGCCCCCTCGCATCAGACACGGGGGCCCTATCTCAG
CACCGCAACGGGGCTTGTGGCAGCCTGCTGACACCTTGCTTCTAGATGCCCGTTTCGAAGTGCTCGGGTCGCCCT
ACTCACTCCTCTCCGTCACCTTGTCGGCGTCTCAAAAGCTTTATACCCGCCGAGGCACGCTGGTTGCTGTTGCAG
GAAAGCCCGACAATGTAGGATCAGTCGAGAGTTCATCGAGGCGACATGGATAGCAAGGAACTGACGAGTGCCTTT
CTCGTCGCAGGCTCAGTCGACCTTGTCATTGCTGAACCCCTTGACAAGGGCAATCTTTGGCGTGCCATTTCTTTA
TCAGCGCATATCCGCCACCACGCCCATGACAGCCCTAATTTCTACAAAGTCACCAACAACCAGCTTCACCGTTAT
TCGTCTCGACGGCACCACTGATTGGATCATATCGCAGCGCAACGCACTGCTGGCCTGGACTGGATATACTTTGAA
GCTCTCGTCTCGTGTTGAAAATCGACTGTCGCTAGCCCATTGGGGCAGCACCTACCTAACAGGGCGTGGGCTTGC
CGCTGTGTCGGCGCCGGGTCAGATATACCAGCTCACCCTCTCCGAAGGGGACGAGTTTGTGGCGCATCCCGGCAG
TGTCGTGGCATATGCAGTGTCGAGGAATCCCCCGCAGCCCTTTAGATTCAAGAGCTCCAGCCTCAGGCTTCAGGT
CCCGTCGCTGAAGTCTTGGATTCCCGAAACCGACTTCTTGAAGAACATGCGGCAAACCGAGACGTACAAATTTGT
CGCCCGCCTACTCTTTCGTCTCCGGACAATGGCGCGACGCACCATTTGGGGCGACCGTCTGTTTTTACATTTCAA
AGGCCCAACCACACTGCTCATGTCGAGTCGTGGTGTGCGCGTGGCCGATGTGCTCTCCCCGGAACAAGTCAATGA
AGTAGCCGATGCTCCTGCTGGAGTAACACCCAGGGCTGTTGAGCTACCTGATACTGCAAAGACGTCGTTGGACCA
AGCGCAAGCTCCTGCTATACCATTGAGCGAACAGCCTCCTAGCGCTCTGCACGTGGCGTCAGTTCGAAGAGACGG
AAAAGTGACTTTTGAGGACCAAAAAGACCTCAAGGAATTTGTGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail