Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|778
Gene name
LocationContig_12:50698..55431
Strand-
Gene length (bp)4733
Transcript length (bp)4530
Coding sequence length (bp)4530
Protein length (aa) 1510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12816 Vps8 Golgi CORVET complex core vacuolar protein 8 1.0E-72 710 932

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0P5W1|VPS8_MOUSE Vacuolar protein sorting-associated protein 8 homolog OS=Mus musculus GN=Vps8 PE=1 SV=1 184 1469 4.0E-77
sp|Q8N3P4|VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens GN=VPS8 PE=1 SV=3 184 1469 7.0E-74
sp|P39702|VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS8 PE=1 SV=2 495 1490 6.0E-64
sp|O13756|VPS8_SCHPO Vacuolar protein sorting-associated protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps8 PE=3 SV=1 157 1065 9.0E-22
sp|P39702|VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS8 PE=1 SV=2 184 330 6.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|778
MSQSRTPSSETDTGPESGETRRQQSNGEDADIAQLEERDSPGVETGTCSAARREDGHKDEARDGGSEMSSPDASL
VDALPRRAGSPSGSVASGAEGSPSVPGSVVSSLGSSAPRSVASRAGFNSPTPSFRPFDRRFQARISSASASPRAA
SPAFLSAHSRNVSLSTSILLHHADNEASSPPWDVVQWTRLKKLNGQAFSEAGRRNFGSPTCLAVSASIVLGTSKG
IILMFDYSQNLKMIIGQGTKAVESGPVTSIAISADHTTIAGGHANGSIFTWDTSRAARPFLSIPHLDTAQDQDQT
VDGHVANVSVIHLGFLGTRHTALVSADDRGMAFSHLATRGTGALGRTVKTTRILGRYPTAPAPMPPGKPLKPSTV
LAFAPLPLGNVERASDAMGLTAMLTPYLLVIVSTTPVAQTQHKSARPKDVAAHSAMTGCLAWFPAVKLKTAARSD
KSKVKLVYCWSNVLTVLDVDEIPSHDGDKLPDLKFKARSRWKCEEAIVAVQWLSRSVLILLTISQRLIVLEDDSM
RMTEALDMLQKHIFHADVFSKQLHSLVEQLDEQDPSMHGVVADAFYMSFKAYKGRIFTLGFNEVSLGALSNWADR
LIAMMEHGDYIGAIRLATSYYLGDADKLTIGLAQDATTRHAVVHDKMMEIVTASLKYAFGRRSSNESQVSDDHLK
ELAQVCLVACQAAGATDYLFEDVYEWYSSANVGAIFHETLEPYILEEAITVVPPAVIKDMVDYYVSRGWESRLEE
IICHMETTTLDLDQVTHLCKQHGLYDALTYVWNQAIGDYISPMIDLLSLLLPHDDDDDSNSNSNSNSNSNSNNNN
NKGDQARENKAAGFGSVDALKIFPYLSYSLTGRVYPSGEFMSHETATTAKSQIYWFFFSGQTIAWPKGSNHEFLT
RPKGEAQPAFPYLRLILEFDAPSFLSTLNEAFEDSFLNDSPDKQVNGASRVDMAEEQIFGLTINRQYILTILVDV
MNPGDFAPEDIIYLDMFIARNLAKFPQYLLLPGSTMSKVLTGLCNYPGAEVADDAQLSAEYLLSVFHPPDMPALI
LLLRQAGFYRILKRIYRAEKQYGKLVKVYFEDPEDQTSVFDCISGCLRRQSRLNDRQVQDIRQAVRDEARKLLEL
DAEQAALTLASEETALHRHLINSAHDRPDLQYAYLKALLEPSKCLDERPEALDGDLVELYVQLMCKFDAQHVSDY
IGAVQFANLRLENLLPAMEATGVVDAAVVLMARDGQINKAMERLLKHLWTLESAFHGLLNGSKGSECYESAQELM
GGLQKYVHVGIWLCQGQTKTSRRTSVVDGNQTTSTDGLSADEQLWLRLIDACVQVTRRLSPHVQKLDEDEAGDGK
LLRLLRSLVQHTFTCLLTATSAQAKHGQTGASKVLTNAGTNVSFLRILRAFLAQAAATSPNLADLRGVLASIFSA
YAYEESILRLSSRLLERSLFVNVRQAVELRQRGWRPRTSTCQACGKRVWGPGVAAGGAVFEAWEDKEAARAQAKK
QREARATEG*
Coding >OphauG2|778
ATGTCCCAATCCCGAACCCCGTCTTCCGAGACGGACACGGGCCCTGAAAGCGGGGAGACAAGGCGGCAGCAGAGC
AATGGAGAGGATGCCGATATTGCGCAGCTTGAGGAGCGAGACTCGCCCGGGGTCGAGACTGGCACTTGCTCAGCG
GCCCGACGAGAGGATGGCCACAAAGACGAAGCCCGAGACGGTGGCTCCGAGATGAGCTCCCCTGACGCAAGCTTA
GTCGATGCCTTGCCCAGAAGAGCTGGCAGTCCCAGCGGCTCAGTAGCATCTGGGGCTGAAGGCTCGCCCTCTGTC
CCGGGATCCGTCGTTTCGTCCCTTGGAAGCAGTGCCCCTCGCTCAGTGGCGTCACGCGCAGGTTTCAACAGCCCG
ACCCCGTCCTTCAGACCATTTGATCGCCGCTTCCAGGCTCGCATATCTTCGGCTTCGGCCAGCCCCCGTGCCGCG
TCGCCTGCATTCCTATCTGCGCATAGTCGCAACGTTTCGCTCAGTACGAGCATTCTGCTCCATCACGCCGACAAT
GAAGCATCAAGCCCGCCGTGGGACGTTGTGCAATGGACCAGGCTGAAAAAACTCAACGGCCAGGCCTTTTCGGAA
GCCGGACGCCGCAATTTTGGCTCGCCAACATGTCTTGCCGTGTCGGCATCAATTGTGCTCGGGACGTCCAAGGGG
ATAATTCTAATGTTTGATTACAGCCAGAATCTCAAGATGATTATTGGACAGGGAACAAAGGCTGTGGAATCTGGC
CCCGTTACCTCGATTGCTATTTCTGCCGATCATACAACTATTGCTGGGGGGCATGCAAACGGCAGCATCTTCACC
TGGGATACGTCGAGGGCGGCCCGACCCTTTCTCTCCATACCACACCTCGACACAGCTCAAGACCAGGACCAAACA
GTCGATGGCCATGTTGCCAATGTATCCGTTATTCACCTTGGCTTCCTCGGAACCAGGCATACGGCGCTTGTATCC
GCAGATGATCGGGGAATGGCCTTTTCTCATCTTGCCACGCGAGGCACCGGCGCTCTTGGCCGGACTGTCAAGACG
ACTCGAATATTGGGCCGCTATCCCACTGCACCTGCACCAATGCCGCCTGGCAAGCCACTGAAGCCTAGCACAGTC
TTGGCTTTTGCGCCGCTGCCATTGGGCAACGTTGAGCGGGCTAGCGACGCCATGGGCTTGACGGCAATGCTTACC
CCGTATCTGCTGGTCATTGTATCCACGACACCCGTTGCCCAGACGCAGCACAAGTCTGCCCGGCCAAAGGACGTT
GCAGCCCACAGTGCCATGACGGGATGCCTTGCTTGGTTTCCCGCCGTCAAGCTCAAAACAGCAGCAAGAAGCGAC
AAGTCCAAGGTCAAGCTGGTCTATTGCTGGTCAAACGTCTTGACAGTGCTCGATGTGGACGAAATCCCCAGCCAT
GATGGAGACAAGCTGCCCGACCTGAAATTCAAAGCGCGAAGCAGGTGGAAGTGTGAGGAGGCCATTGTTGCTGTG
CAGTGGCTGAGCCGCTCGGTGCTGATATTGCTCACGATATCCCAGCGGCTCATAGTCTTGGAGGATGATAGTATG
CGCATGACTGAAGCCTTGGACATGCTGCAGAAGCACATTTTTCACGCAGATGTCTTTTCAAAACAGCTGCATAGC
CTGGTGGAGCAGCTGGACGAGCAAGATCCATCCATGCATGGCGTTGTGGCTGATGCCTTTTACATGAGCTTCAAA
GCTTACAAGGGAAGGATATTTACTCTCGGATTCAACGAAGTGTCTCTGGGAGCCTTGTCTAATTGGGCGGATCGT
CTGATTGCCATGATGGAGCACGGTGACTACATTGGGGCTATTCGCCTGGCTACCTCGTACTACCTGGGCGACGCT
GACAAGCTCACCATTGGCCTGGCCCAAGACGCAACGACAAGACACGCCGTGGTGCACGACAAGATGATGGAGATT
GTCACGGCCTCTCTCAAGTATGCTTTTGGCCGGCGGTCAAGCAATGAGAGCCAGGTCAGCGACGACCACTTGAAG
GAACTTGCCCAAGTCTGCCTAGTTGCATGCCAGGCAGCAGGAGCCACGGATTACCTGTTTGAAGATGTCTACGAG
TGGTACAGCAGTGCCAATGTCGGCGCCATCTTTCATGAGACGCTGGAACCGTATATACTGGAAGAAGCCATCACA
GTGGTGCCTCCTGCTGTCATCAAAGACATGGTTGACTACTATGTCTCAAGGGGCTGGGAAAGCAGGCTGGAGGAG
ATTATCTGCCACATGGAGACGACGACTCTTGACCTGGACCAAGTCACGCATCTCTGCAAGCAGCACGGCTTATAC
GACGCCCTGACCTATGTCTGGAACCAGGCCATTGGCGATTACATTAGTCCCATGATTGATTTGCTGAGTCTCCTG
TTGCCGCACGACGACGACGACGACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAATAACAACAAC
AACAAGGGGGACCAAGCCCGAGAGAACAAGGCTGCTGGATTTGGTAGCGTGGACGCGCTCAAGATTTTCCCCTAT
CTGTCGTATTCCTTGACCGGGCGAGTGTACCCCAGCGGAGAATTCATGTCGCACGAGACAGCAACCACGGCCAAG
TCGCAAATCTATTGGTTCTTCTTTTCCGGACAGACAATTGCCTGGCCCAAGGGCAGTAACCACGAGTTTTTGACG
CGACCCAAGGGCGAGGCACAGCCGGCGTTTCCATACCTGCGGCTGATTCTCGAATTCGACGCTCCAAGCTTCCTG
AGCACACTAAACGAAGCCTTTGAGGACTCGTTCCTCAACGACTCTCCCGACAAGCAGGTGAATGGGGCGTCTCGC
GTGGACATGGCTGAAGAGCAGATTTTTGGTCTCACGATTAACCGTCAATACATACTGACCATTCTTGTCGACGTG
ATGAATCCCGGCGACTTTGCGCCCGAGGACATCATTTACCTCGACATGTTTATTGCCCGCAACCTGGCCAAGTTT
CCGCAATATCTTCTCTTGCCAGGATCCACAATGTCCAAGGTGCTCACGGGCCTCTGCAACTACCCAGGCGCCGAG
GTTGCGGATGATGCTCAGCTCAGCGCTGAATATCTCTTGTCTGTTTTCCACCCGCCAGACATGCCCGCTCTAATA
TTGCTGCTTCGTCAAGCCGGGTTTTATCGCATTCTCAAGCGCATCTACAGGGCTGAGAAGCAATATGGCAAGCTT
GTCAAGGTTTATTTCGAGGATCCAGAGGATCAGACGAGCGTCTTTGACTGCATATCTGGCTGTCTGCGTCGGCAA
AGCAGACTCAACGACCGCCAAGTGCAGGATATACGGCAAGCCGTGCGAGACGAGGCCAGGAAGCTACTTGAACTT
GATGCGGAACAGGCAGCCTTGACGTTGGCGTCTGAGGAGACGGCACTTCATCGCCACCTGATCAACTCTGCACAT
GACCGGCCAGACCTACAGTACGCATATCTCAAGGCATTGCTTGAGCCGAGCAAGTGCCTGGATGAGCGACCAGAG
GCCCTGGACGGAGATTTGGTGGAGCTCTATGTTCAGCTCATGTGCAAGTTTGACGCACAACATGTGTCTGACTAT
ATCGGAGCTGTTCAGTTTGCTAATCTACGATTGGAAAACCTCTTGCCAGCCATGGAGGCGACGGGTGTTGTGGAT
GCGGCTGTTGTGCTCATGGCGCGGGATGGCCAAATAAACAAGGCCATGGAGCGTCTGCTGAAGCATCTCTGGACG
CTCGAGTCGGCCTTTCACGGCCTCTTGAACGGGAGCAAGGGCAGCGAATGCTACGAATCTGCACAAGAGCTGATG
GGCGGCCTGCAGAAATACGTACATGTTGGTATCTGGCTTTGTCAGGGCCAGACAAAGACGTCGCGGCGGACAAGC
GTTGTTGATGGCAATCAAACGACTTCCACGGACGGACTGTCGGCCGATGAACAGCTTTGGCTCAGGCTGATTGAT
GCCTGTGTTCAGGTGACGAGGCGGCTCTCGCCCCATGTGCAGAAACTGGATGAAGACGAGGCTGGAGATGGCAAG
CTCCTGAGGCTGTTGAGGTCTCTAGTCCAGCACACTTTTACCTGTCTTCTCACGGCAACGTCTGCGCAAGCAAAG
CATGGACAGACTGGGGCCAGCAAGGTCTTGACGAATGCGGGGACCAATGTTTCCTTTCTCCGTATTCTGAGGGCC
TTTCTCGCGCAGGCAGCTGCAACATCGCCGAATCTGGCCGACTTGCGAGGGGTGCTGGCGAGTATATTTTCAGCT
TATGCGTACGAGGAGTCGATTCTGCGACTGTCGAGCCGGCTGCTGGAGCGAAGTCTATTTGTCAATGTCCGACAG
GCGGTGGAGCTGCGGCAACGAGGATGGCGGCCACGCACATCTACATGCCAGGCGTGCGGCAAGAGAGTTTGGGGC
CCTGGAGTGGCAGCAGGGGGCGCCGTGTTTGAGGCGTGGGAGGATAAAGAAGCGGCGCGAGCGCAGGCAAAGAAG
CAGCGGGAGGCGAGAGCGACTGAAGGCTGA
Transcript >OphauG2|778
ATGTCCCAATCCCGAACCCCGTCTTCCGAGACGGACACGGGCCCTGAAAGCGGGGAGACAAGGCGGCAGCAGAGC
AATGGAGAGGATGCCGATATTGCGCAGCTTGAGGAGCGAGACTCGCCCGGGGTCGAGACTGGCACTTGCTCAGCG
GCCCGACGAGAGGATGGCCACAAAGACGAAGCCCGAGACGGTGGCTCCGAGATGAGCTCCCCTGACGCAAGCTTA
GTCGATGCCTTGCCCAGAAGAGCTGGCAGTCCCAGCGGCTCAGTAGCATCTGGGGCTGAAGGCTCGCCCTCTGTC
CCGGGATCCGTCGTTTCGTCCCTTGGAAGCAGTGCCCCTCGCTCAGTGGCGTCACGCGCAGGTTTCAACAGCCCG
ACCCCGTCCTTCAGACCATTTGATCGCCGCTTCCAGGCTCGCATATCTTCGGCTTCGGCCAGCCCCCGTGCCGCG
TCGCCTGCATTCCTATCTGCGCATAGTCGCAACGTTTCGCTCAGTACGAGCATTCTGCTCCATCACGCCGACAAT
GAAGCATCAAGCCCGCCGTGGGACGTTGTGCAATGGACCAGGCTGAAAAAACTCAACGGCCAGGCCTTTTCGGAA
GCCGGACGCCGCAATTTTGGCTCGCCAACATGTCTTGCCGTGTCGGCATCAATTGTGCTCGGGACGTCCAAGGGG
ATAATTCTAATGTTTGATTACAGCCAGAATCTCAAGATGATTATTGGACAGGGAACAAAGGCTGTGGAATCTGGC
CCCGTTACCTCGATTGCTATTTCTGCCGATCATACAACTATTGCTGGGGGGCATGCAAACGGCAGCATCTTCACC
TGGGATACGTCGAGGGCGGCCCGACCCTTTCTCTCCATACCACACCTCGACACAGCTCAAGACCAGGACCAAACA
GTCGATGGCCATGTTGCCAATGTATCCGTTATTCACCTTGGCTTCCTCGGAACCAGGCATACGGCGCTTGTATCC
GCAGATGATCGGGGAATGGCCTTTTCTCATCTTGCCACGCGAGGCACCGGCGCTCTTGGCCGGACTGTCAAGACG
ACTCGAATATTGGGCCGCTATCCCACTGCACCTGCACCAATGCCGCCTGGCAAGCCACTGAAGCCTAGCACAGTC
TTGGCTTTTGCGCCGCTGCCATTGGGCAACGTTGAGCGGGCTAGCGACGCCATGGGCTTGACGGCAATGCTTACC
CCGTATCTGCTGGTCATTGTATCCACGACACCCGTTGCCCAGACGCAGCACAAGTCTGCCCGGCCAAAGGACGTT
GCAGCCCACAGTGCCATGACGGGATGCCTTGCTTGGTTTCCCGCCGTCAAGCTCAAAACAGCAGCAAGAAGCGAC
AAGTCCAAGGTCAAGCTGGTCTATTGCTGGTCAAACGTCTTGACAGTGCTCGATGTGGACGAAATCCCCAGCCAT
GATGGAGACAAGCTGCCCGACCTGAAATTCAAAGCGCGAAGCAGGTGGAAGTGTGAGGAGGCCATTGTTGCTGTG
CAGTGGCTGAGCCGCTCGGTGCTGATATTGCTCACGATATCCCAGCGGCTCATAGTCTTGGAGGATGATAGTATG
CGCATGACTGAAGCCTTGGACATGCTGCAGAAGCACATTTTTCACGCAGATGTCTTTTCAAAACAGCTGCATAGC
CTGGTGGAGCAGCTGGACGAGCAAGATCCATCCATGCATGGCGTTGTGGCTGATGCCTTTTACATGAGCTTCAAA
GCTTACAAGGGAAGGATATTTACTCTCGGATTCAACGAAGTGTCTCTGGGAGCCTTGTCTAATTGGGCGGATCGT
CTGATTGCCATGATGGAGCACGGTGACTACATTGGGGCTATTCGCCTGGCTACCTCGTACTACCTGGGCGACGCT
GACAAGCTCACCATTGGCCTGGCCCAAGACGCAACGACAAGACACGCCGTGGTGCACGACAAGATGATGGAGATT
GTCACGGCCTCTCTCAAGTATGCTTTTGGCCGGCGGTCAAGCAATGAGAGCCAGGTCAGCGACGACCACTTGAAG
GAACTTGCCCAAGTCTGCCTAGTTGCATGCCAGGCAGCAGGAGCCACGGATTACCTGTTTGAAGATGTCTACGAG
TGGTACAGCAGTGCCAATGTCGGCGCCATCTTTCATGAGACGCTGGAACCGTATATACTGGAAGAAGCCATCACA
GTGGTGCCTCCTGCTGTCATCAAAGACATGGTTGACTACTATGTCTCAAGGGGCTGGGAAAGCAGGCTGGAGGAG
ATTATCTGCCACATGGAGACGACGACTCTTGACCTGGACCAAGTCACGCATCTCTGCAAGCAGCACGGCTTATAC
GACGCCCTGACCTATGTCTGGAACCAGGCCATTGGCGATTACATTAGTCCCATGATTGATTTGCTGAGTCTCCTG
TTGCCGCACGACGACGACGACGACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAATAACAACAAC
AACAAGGGGGACCAAGCCCGAGAGAACAAGGCTGCTGGATTTGGTAGCGTGGACGCGCTCAAGATTTTCCCCTAT
CTGTCGTATTCCTTGACCGGGCGAGTGTACCCCAGCGGAGAATTCATGTCGCACGAGACAGCAACCACGGCCAAG
TCGCAAATCTATTGGTTCTTCTTTTCCGGACAGACAATTGCCTGGCCCAAGGGCAGTAACCACGAGTTTTTGACG
CGACCCAAGGGCGAGGCACAGCCGGCGTTTCCATACCTGCGGCTGATTCTCGAATTCGACGCTCCAAGCTTCCTG
AGCACACTAAACGAAGCCTTTGAGGACTCGTTCCTCAACGACTCTCCCGACAAGCAGGTGAATGGGGCGTCTCGC
GTGGACATGGCTGAAGAGCAGATTTTTGGTCTCACGATTAACCGTCAATACATACTGACCATTCTTGTCGACGTG
ATGAATCCCGGCGACTTTGCGCCCGAGGACATCATTTACCTCGACATGTTTATTGCCCGCAACCTGGCCAAGTTT
CCGCAATATCTTCTCTTGCCAGGATCCACAATGTCCAAGGTGCTCACGGGCCTCTGCAACTACCCAGGCGCCGAG
GTTGCGGATGATGCTCAGCTCAGCGCTGAATATCTCTTGTCTGTTTTCCACCCGCCAGACATGCCCGCTCTAATA
TTGCTGCTTCGTCAAGCCGGGTTTTATCGCATTCTCAAGCGCATCTACAGGGCTGAGAAGCAATATGGCAAGCTT
GTCAAGGTTTATTTCGAGGATCCAGAGGATCAGACGAGCGTCTTTGACTGCATATCTGGCTGTCTGCGTCGGCAA
AGCAGACTCAACGACCGCCAAGTGCAGGATATACGGCAAGCCGTGCGAGACGAGGCCAGGAAGCTACTTGAACTT
GATGCGGAACAGGCAGCCTTGACGTTGGCGTCTGAGGAGACGGCACTTCATCGCCACCTGATCAACTCTGCACAT
GACCGGCCAGACCTACAGTACGCATATCTCAAGGCATTGCTTGAGCCGAGCAAGTGCCTGGATGAGCGACCAGAG
GCCCTGGACGGAGATTTGGTGGAGCTCTATGTTCAGCTCATGTGCAAGTTTGACGCACAACATGTGTCTGACTAT
ATCGGAGCTGTTCAGTTTGCTAATCTACGATTGGAAAACCTCTTGCCAGCCATGGAGGCGACGGGTGTTGTGGAT
GCGGCTGTTGTGCTCATGGCGCGGGATGGCCAAATAAACAAGGCCATGGAGCGTCTGCTGAAGCATCTCTGGACG
CTCGAGTCGGCCTTTCACGGCCTCTTGAACGGGAGCAAGGGCAGCGAATGCTACGAATCTGCACAAGAGCTGATG
GGCGGCCTGCAGAAATACGTACATGTTGGTATCTGGCTTTGTCAGGGCCAGACAAAGACGTCGCGGCGGACAAGC
GTTGTTGATGGCAATCAAACGACTTCCACGGACGGACTGTCGGCCGATGAACAGCTTTGGCTCAGGCTGATTGAT
GCCTGTGTTCAGGTGACGAGGCGGCTCTCGCCCCATGTGCAGAAACTGGATGAAGACGAGGCTGGAGATGGCAAG
CTCCTGAGGCTGTTGAGGTCTCTAGTCCAGCACACTTTTACCTGTCTTCTCACGGCAACGTCTGCGCAAGCAAAG
CATGGACAGACTGGGGCCAGCAAGGTCTTGACGAATGCGGGGACCAATGTTTCCTTTCTCCGTATTCTGAGGGCC
TTTCTCGCGCAGGCAGCTGCAACATCGCCGAATCTGGCCGACTTGCGAGGGGTGCTGGCGAGTATATTTTCAGCT
TATGCGTACGAGGAGTCGATTCTGCGACTGTCGAGCCGGCTGCTGGAGCGAAGTCTATTTGTCAATGTCCGACAG
GCGGTGGAGCTGCGGCAACGAGGATGGCGGCCACGCACATCTACATGCCAGGCGTGCGGCAAGAGAGTTTGGGGC
CCTGGAGTGGCAGCAGGGGGCGCCGTGTTTGAGGCGTGGGAGGATAAAGAAGCGGCGCGAGCGCAGGCAAAGAAG
CAGCGGGAGGCGAGAGCGACTGAAGGCTGA
Gene >OphauG2|778
ATGTCCCAATCCCGAACCCCGTCTTCCGAGACGGACACGGGCCCTGAAAGCGGGGAGACAAGGCGGCAGCAGAGC
AATGGAGAGGATGCCGATATTGCGCAGCTTGAGGAGCGAGACTCGCCCGGGGTCGAGACTGGCACTTGCTCAGCG
GCCCGACGAGAGGATGGCCACAAAGACGAAGCCCGAGACGGTGGCTCCGAGATGAGCTCCCCTGACGCAAGCTTA
GTCGATGCCTTGCCCAGAAGAGCTGGCAGTCCCAGCGGCTCAGTAGCATCTGGGGCTGAAGGCTCGCCCTCTGTC
CCGGTATGCGCATCAGAGAGCAGTGTTGACGAGGCGACGTGAAGAATGGAAACTGATATACAGCACAGGGATCCG
TCGTTTCGTCCCTTGGAAGCAGTGCCCCTCGCTCAGTGGCGTCACGCGCAGGTTTCAACAGCCCGACCCCGTCCT
TCAGACCATTTGATCGCCGCTTCCAGGCTCGCATATCTTCGGCTTCGGCCAGCCCCCGTGCCGCGTCGCCTGCAT
TCCTATCTGCGCATAGTCGCAACGTTTCGCTCAGTACGAGCATTCTGCTCCATCACGCCGACAATGAAGCATCAA
GCCCGCCGTGGGACGTTGTGCAATGGACCAGGCTGAAAAAACTCAACGGCCAGGCCTTTTCGGAAGCCGGACGCC
GCAATTTTGGCTCGCCAACATGTCTTGCCGTGTCGGCATCAATTGTGCTCGGGACGTCCAAGGGGATAATTCTAA
TGTTTGATTACAGCCAGAATCTCAAGATGATTATTGGACAGGGAACAAAGGGTGAGAAGACACACGCACCAACTC
TGCTTTACGCCAAGAGAAATCACGGTAGCGACTGACTGCTTTAGCTGTGGAATCTGGCCCCGTTACCTCGATTGC
TATTTCTGCCGATCATACAACTATTGCTGGGGGGCATGCAAACGGCAGCATCTTCACCTGGGATACGTCGAGGGC
GGCCCGACCCTTTCTCTCCATACCACACCTCGACACAGCTCAAGACCAGGACCAAACAGTCGATGGCCATGTTGC
CAATGTATCCGTTATTCACCTTGGCTTCCTCGGAACCAGGCATACGGCGCTTGTATCCGCAGATGATCGGGGAAT
GGCCTTTTCTCATCTTGCCACGCGAGGCACCGGCGCTCTTGGCCGGACTGTCAAGACGACTCGAATATTGGGCCG
CTATCCCACTGCACCTGCACCAATGCCGCCTGGCAAGCCACTGAAGCCTAGCACAGTCTTGGCTTTTGCGCCGCT
GCCATTGGGCAACGTTGAGCGGGCTAGCGACGCCATGGGCTTGACGGCAATGCTTACCCCGTATCTGCTGGTCAT
TGTATCCACGACACCCGTTGCCCAGACGCAGCACAAGTCTGCCCGGCCAAAGGACGTTGCAGCCCACAGTGCCAT
GACGGGATGCCTTGCTTGGTTTCCCGCCGTCAAGCTCAAAACAGCAGCAAGAAGCGACAAGTCCAAGGTCAAGCT
GGTCTATTGCTGGTCAAACGTCTTGACAGTGCTCGATGTGGACGAAATCCCCAGCCATGATGGAGACAAGCTGCC
CGACCTGAAATTCAAAGCGCGAAGCAGGTGGAAGTGTGAGGAGGCCATTGTTGCTGTGCAGTGGCTGAGCCGCTC
GGTGCTGATATTGCTCACGATATCCCAGCGGCTCATAGTCTTGGAGGATGATAGTATGCGCATGACTGAAGCCTT
GGACATGCTGCAGAAGCACATTTTTCACGCAGATGTCTTTTCAAAACAGCTGCATAGCCTGGTGGAGCAGCTGGA
CGAGCAAGATCCATCCATGCATGGCGTTGTGGCTGATGCCTTTTACATGAGCTTCAAAGCTTACAAGGGAAGGAT
ATTTACTCTCGGATTCAACGAAGTGTCTCTGGGAGCCTTGTCTAATTGGGCGGATCGTCTGATTGCCATGATGGA
GCACGGTGACTACATTGGGGCTATTCGCCTGGCTACCTCGTACTACCTGGGCGACGCTGACAAGCTCACCATTGG
CCTGGCCCAAGACGCAACGACAAGACACGCCGTGGTGCACGACAAGATGATGGAGATTGTCACGGCCTCTCTCAA
GTATGCTTTTGGCCGGCGGTCAAGCAATGAGAGCCAGGTCAGCGACGACCACTTGAAGGAACTTGCCCAAGTCTG
CCTAGTTGCATGCCAGGCAGCAGGAGCCACGGATTACCTGTTTGAAGATGTCTACGAGTGGTACAGCAGTGCCAA
TGTCGGCGCCATCTTTCATGAGACGCTGGAACCGTATATACTGGAAGAAGCCATCACAGTGGTGCCTCCTGCTGT
CATCAAAGACATGGTTGACTACTATGTCTCAAGGGGCTGGGAAAGCAGGCTGGAGGAGATTATCTGCCACATGGA
GACGACGACTCTTGACCTGGACCAAGTCACGCATCTCTGCAAGCAGCACGGCTTATACGACGCCCTGACCTATGT
CTGGAACCAGGCCATTGGCGATTACATTAGTCCCATGATTGATTTGCTGAGTCTCCTGTTGCCGCACGACGACGA
CGACGACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAATAACAACAACAACAAGGGGGACCAAGC
CCGAGAGAACAAGGCTGCTGGATTTGGTAGCGTGGACGCGCTCAAGATTTTCCCCTATCTGTCGTATTCCTTGAC
CGGGCGAGTGTACCCCAGCGGAGAATTCATGTCGCACGAGACAGCAACCACGGCCAAGTCGCAAATCTATTGGTT
CTTCTTTTCCGGACAGACAATTGCCTGGCCCAAGGGCAGTAACCACGAGTTTTTGACGCGACCCAAGGGCGAGGC
ACAGCCGGCGTTTCCATACCTGCGGCTGATTCTCGAATTCGACGCTCCAAGCTTCCTGAGCACACTAAACGAAGC
CTTTGAGGACTCGTTCCTCAACGACTCTCCCGACAAGCAGGTGAATGGGGCGTCTCGCGTGGACATGGCTGAAGA
GCAGATTTTTGGTCTCACGATTAACCGTCAATACATACTGACCATTCTTGTCGACGTGATGAATCCCGGCGACTT
TGCGCCCGAGGACATCATTTACCTCGACATGTTTATTGCCCGCAACCTGGCCAAGTTTCCGCAATATCTTCTCTT
GCCAGGATCCACAATGTCCAAGGTGCTCACGGGCCTCTGCAACTACCCAGGCGCCGAGGTTGCGGATGATGCTCA
GCTCAGCGCTGAATATCTCTTGTCTGTTTTCCACCCGCCAGACATGCCCGCTCTAATATTGCTGCTTCGTCAAGC
CGGGTTTTATCGCATTCTCAAGCGCATCTACAGGGCTGAGAAGCAATATGGCAAGCTTGTCAAGGTTTATTTCGA
GGATCCAGAGGATCAGACGAGCGTCTTTGACTGCATATCTGGCTGTCTGCGTCGGCAAAGCAGACTCAACGACCG
CCAAGTGCAGGATATACGGCAAGCCGTGCGAGACGAGGCCAGGAAGCTACTTGAACTTGATGCGGAACAGGCAGC
CTTGACGTTGGCGTCTGAGGAGACGGCACTTCATCGCCACCTGATCAACTCTGCACATGACCGGCCAGACCTACA
GTACGCATATCTCAAGGCATTGCTTGAGCCGAGCAAGTGCCTGGATGAGCGACCAGAGGCCCTGGACGGAGATTT
GGTGGAGCTCTATGTTCAGCTCATGTGCAAGTTTGACGCACAACATGTGTCTGACTATATCGGAGCTGTTCAGTT
TGCTAATCTACGATTGGAAAACCTCTTGCCAGCCATGGAGGCGACGGGTGTTGTGGATGCGGCTGTTGTGCTCAT
GGCGCGGGATGGCCAAATAAACAAGGCCATGGAGCGTCTGCTGAAGCATCTCTGGACGCTCGAGTCGGCCTTTCA
CGGCCTCTTGAACGGGAGCAAGGGCAGCGAATGCTACGAATCTGCACAAGAGCTGATGGGCGGCCTGCAGAAATA
CGTACATGTTGGTATCTGGCTTTGTCAGGGCCAGACAAAGACGTCGCGGCGGACAAGCGTTGTTGATGGCAATCA
AACGACTTCCACGGACGGACTGTCGGCCGATGAACAGCTTTGGCTCAGGCTGATTGATGCCTGTGTTCAGGTGAC
GAGGCGGCTCTCGCCCCATGTGCAGAAACTGGATGAAGACGAGGCTGGAGATGGCAAGCTCCTGAGGCTGTTGAG
GTCTCTAGTCCAGCACACTTTTACCTGTCTTCTCACGGCAACGTCTGCGCAAGCAAAGCATGGACAGACTGGGGC
CAGCAAGGTCTTGACGAATGCGGGGACCAATGTTTCCTTTCTCCGTATTCTGAGGGCCTTTCTCGCGCAGGCAGC
TGCAACATCGCCGAATCTGGCCGACTTGCGAGGGGTGCTGGCGAGTATATTTTCAGCTTATGCGTACGAGGAGTC
GATTCTGCGACTGTCGAGCCGGCTGCTGGAGCGAAGTCTATTTGTCAATGTCCGACAGGCGGTGGAGCTGCGGCA
ACGAGGATGGCGGCCACGCACATCTACATGCCAGGCGTGCGGCAAGAGAGTTTGGGGCCCTGGAGTGGCAGCAGG
GGGCGCCGTGTTTGAGGCGTGGGAGGATAAAGAAGCGGCGCGAGCGCAGGCAAAGAAGCAGCGGGAGGCGAGAGC
GACTGAAGGCGTACGGGGCGAGGCGGGGGCGGGGGTGGACGTGGGCATGGGCAAAGGCAAAGGGCTAGAGGTTCG
GCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail