Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7777
Gene name
LocationContig_941:3838..5179
Strand-
Gene length (bp)1341
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 5.0E-11 57 269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08219|RRT8_YEAST Outer spore wall protein RRT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT8 PE=1 SV=2 48 284 3.0E-18
sp|P31379|LDS1_YEAST Outer spore wall protein LDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDS1 PE=1 SV=1 48 283 5.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 101 123 22
3 194 216 22
4 246 268 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7777
MADPPSCTHQNQSPESSRHRHRLANSLGEKAQQVLKDDYSKARLVAFDALKSRAFLYPFKGIVYFLGHRSLWQPF
ISRLGPFATLSASVIAGMFTLTYLPQLAVQVFVSGPFAVVSTVLLVLSESSAIINVIARTWLLQDAILDTFDGTL
LSRNATAVLREGREIKPGRDPMQKLGKIIKSPFKRFTPKALIRYLIYLPLNFVPLVGTVMFIYLQGRNRGRQVHG
RYFQLKKWSTWQQKDWLNKHVGAYTAFGLVATFLEMIPLASIFFTYTNAVGAALWAADIETLNASMTDGTAPGLR
ETAKEAE*
Coding >OphauG2|7777
ATGGCCGACCCTCCAAGCTGCACCCATCAAAATCAAAGCCCCGAGTCAAGCAGACACCGCCACCGCCTTGCCAAC
TCGCTGGGTGAAAAGGCCCAGCAGGTTCTCAAGGACGATTACTCCAAGGCCCGACTCGTCGCCTTTGACGCGCTC
AAGAGCCGTGCTTTCCTCTATCCCTTCAAGGGTATTGTCTACTTTCTCGGCCACCGCTCCCTATGGCAGCCCTTC
ATCTCCCGTCTGGGCCCCTTTGCCACTCTCTCTGCCAGCGTCATTGCTGGCATGTTTACCTTGACCTACCTCCCT
CAGTTGGCCGTCCAGGTTTTTGTCAGCGGTCCCTTTGCCGTTGTCTCCACCGTGTTGCTTGTCCTTAGTGAGAGC
TCCGCAATCATCAACGTTATTGCTCGCACATGGCTGCTGCAAGACGCCATCCTTGACACTTTTGACGGCACATTG
TTGAGTCGCAACGCTACAGCAGTCCTCCGAGAGGGTCGCGAGATCAAGCCTGGCCGCGATCCCATGCAAAAGCTC
GGCAAAATCATCAAGAGCCCCTTTAAACGCTTTACCCCAAAGGCTCTCATACGCTATCTCATCTATCTGCCCCTC
AACTTTGTACCTCTTGTCGGTACTGTCATGTTCATATATCTTCAGGGCCGGAACCGTGGCCGGCAAGTTCACGGT
CGATATTTCCAGCTTAAGAAGTGGTCGACTTGGCAACAAAAAGATTGGCTCAACAAACACGTCGGAGCCTATACT
GCCTTTGGCTTGGTTGCCACATTCCTCGAGATGATACCATTGGCGTCCATTTTCTTCACGTATACAAACGCAGTG
GGAGCGGCTCTATGGGCGGCAGACATTGAGACTCTGAACGCATCCATGACGGATGGAACTGCTCCCGGCCTCAGG
GAGACAGCCAAAGAGGCTGAATAA
Transcript >OphauG2|7777
ATGGCCGACCCTCCAAGCTGCACCCATCAAAATCAAAGCCCCGAGTCAAGCAGACACCGCCACCGCCTTGCCAAC
TCGCTGGGTGAAAAGGCCCAGCAGGTTCTCAAGGACGATTACTCCAAGGCCCGACTCGTCGCCTTTGACGCGCTC
AAGAGCCGTGCTTTCCTCTATCCCTTCAAGGGTATTGTCTACTTTCTCGGCCACCGCTCCCTATGGCAGCCCTTC
ATCTCCCGTCTGGGCCCCTTTGCCACTCTCTCTGCCAGCGTCATTGCTGGCATGTTTACCTTGACCTACCTCCCT
CAGTTGGCCGTCCAGGTTTTTGTCAGCGGTCCCTTTGCCGTTGTCTCCACCGTGTTGCTTGTCCTTAGTGAGAGC
TCCGCAATCATCAACGTTATTGCTCGCACATGGCTGCTGCAAGACGCCATCCTTGACACTTTTGACGGCACATTG
TTGAGTCGCAACGCTACAGCAGTCCTCCGAGAGGGTCGCGAGATCAAGCCTGGCCGCGATCCCATGCAAAAGCTC
GGCAAAATCATCAAGAGCCCCTTTAAACGCTTTACCCCAAAGGCTCTCATACGCTATCTCATCTATCTGCCCCTC
AACTTTGTACCTCTTGTCGGTACTGTCATGTTCATATATCTTCAGGGCCGGAACCGTGGCCGGCAAGTTCACGGT
CGATATTTCCAGCTTAAGAAGTGGTCGACTTGGCAACAAAAAGATTGGCTCAACAAACACGTCGGAGCCTATACT
GCCTTTGGCTTGGTTGCCACATTCCTCGAGATGATACCATTGGCGTCCATTTTCTTCACGTATACAAACGCAGTG
GGAGCGGCTCTATGGGCGGCAGACATTGAGACTCTGAACGCATCCATGACGGATGGAACTGCTCCCGGCCTCAGG
GAGACAGCCAAAGAGGCTGAATAA
Gene >OphauG2|7777
ATGGCCGACCCTCCAAGCTGCACCCATCAAAATCAAAGCCCCGAGTCAAGCAGACACCGCCACCGCCTTGCCAAC
TCGCTGGGTGAAAAGGCCCAGCAGGTTCTGTAAGCCCTGCCCACTGCCGCGAGCTCCCCAATGGCCAAGCCATGC
CGCTAACCTTGCTCTTACTCTGTGCTCGGTGCAGCAAGGACGATTACTCCAAGGCCCGACTCGTCGCCTTTGACG
CGCTCAAGAGCCGTGCTTTCCTCTATCCCTTCAAGGTAGAGCTCGCTACTCATGCAACCTCGCCATCCCACAAGA
CGCGCCATTCTTGCCCATGGCTGACACAAACGCCACCACGGCAATCCTCTAGGGTATTGTCTACTTTCTCGGCCA
CCGCTCCCTATGGCAGCCCTTCATCTCCCGTCTGGGCCCCTTTGCCACTCTCTCTGCCAGCGTCATTGCTGGCAT
GTTTACCTTGACCTACCTCCCTCAGTTGGCCGTCCAGGTTTTTGTCAGCGGTCCCTTTGCCGTTGTCTCCACCGT
GTTGCTTGTCCTTAGTGAGAGCTCCGCAATCATCAACGTTATTGCTCGCACATGGCTGCTGCAAGACGCCATCCT
TGACACTTTTGACGGCACATTGTTGAGTCGCAACGCTACAGCAGTCCTCCGAGAGGGTCGCGAGATCAAGCCTGG
CCGCGATCCCATGCAAAAGCTCGGCAAAATCATCAAGAGCCCCTTTAAACGCTTTACCCCAAAGGCTCTCATACG
CTATCTCATCTATCTGCCCCTCAACTTTGTACCTCTTGTCGGTACTGTCATGTTCATATATCTTCAGGGTTTGTC
GCTTCAGTGCTGCAACACTTGTTTTGAGTCTCTGGGCTAATAGCCATCTTAGGCCGGAACCGTGGCCGGCAAGTT
CACGGTCGAGTGGGTTTGCCATGCACAGACAAATACAAGACACAGCTCCTGACTCCAATCCCAGTATTTCCAGCT
TAAGAAGTGGTCGACTTGGCAACAAAAAGATTGGCTCAACAAACACGTCGGAGCCTATACTGCGTATGTGAAACA
GAATCCTCCAAAAAGTCTTGTCATACATGCTTAGTGACCTCTTGGCAAACAGCTTTGGCTTGGTTGCCACATTCC
TCGAGATGATACCATTGGCGTCCATTTTCTTCACGTATACAAACGCAGGTAGGCTTAGGTGACGCTTCATGTGCA
ACTGCTCAATCACGAGACTCCTGCTGACGCATGGCCAAAGTGGGAGCGGCTCTATGGGCGGCAGACATTGAGACT
CTGAACGCATCCATGACGGATGGAACTGCTCCCGGCCTCAGGGAGACAGCCAAAGAGGCTGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail