Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7765
Gene name
LocationContig_94:13185..13656
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999805

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 29 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7765 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6973
Ophiocordyceps kimflemingae Ophio5|3432
Ophiocordyceps subramaniannii Hirsu2|4815
Ophiocordyceps subramaniannii Hirsu2|5464
Ophiocordyceps subramaniannii Hirsu2|7643

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7765
MKCAIILAAAVAAMASALPSGNKPLLPWVSDEERFLPHECGPFGYDEKTCGTLIYCDAFESAIFNKPTGYANTQQ
CLDAHEPAPILPWVAAPNVFRPSSCQVGLISAECPFVCGLFGTFNDKLCGTKRYCEAFDKVKPKPLGYKNTEECF
RAHRAL*
Coding >OphauG2|7765
ATGAAGTGCGCCATCATCCTCGCCGCCGCTGTCGCCGCCATGGCCAGCGCCCTCCCCTCCGGCAACAAGCCACTC
CTCCCTTGGGTCAGCGACGAGGAGCGCTTCCTGCCTCATGAGTGCGGTCCGTTTGGCTATGACGAAAAGACTTGC
GGCACGCTCATTTACTGCGACGCCTTTGAGTCTGCCATCTTCAACAAGCCAACCGGCTATGCCAACACCCAGCAA
TGCCTTGACGCCCATGAGCCTGCGCCCATCCTGCCTTGGGTCGCAGCCCCCAACGTCTTCCGTCCCTCGTCTTGC
CAGGTTGGCTTGATTAGCGCCGAGTGCCCATTCGTTTGTGGGCTCTTTGGCACCTTCAACGACAAGTTGTGCGGC
ACCAAGCGCTACTGCGAGGCCTTTGACAAGGTCAAGCCCAAGCCTCTGGGCTATAAGAACACTGAGGAATGCTTC
AGGGCTCACCGGGCCCTCTAA
Transcript >OphauG2|7765
ATGAAGTGCGCCATCATCCTCGCCGCCGCTGTCGCCGCCATGGCCAGCGCCCTCCCCTCCGGCAACAAGCCACTC
CTCCCTTGGGTCAGCGACGAGGAGCGCTTCCTGCCTCATGAGTGCGGTCCGTTTGGCTATGACGAAAAGACTTGC
GGCACGCTCATTTACTGCGACGCCTTTGAGTCTGCCATCTTCAACAAGCCAACCGGCTATGCCAACACCCAGCAA
TGCCTTGACGCCCATGAGCCTGCGCCCATCCTGCCTTGGGTCGCAGCCCCCAACGTCTTCCGTCCCTCGTCTTGC
CAGGTTGGCTTGATTAGCGCCGAGTGCCCATTCGTTTGTGGGCTCTTTGGCACCTTCAACGACAAGTTGTGCGGC
ACCAAGCGCTACTGCGAGGCCTTTGACAAGGTCAAGCCCAAGCCTCTGGGCTATAAGAACACTGAGGAATGCTTC
AGGGCTCACCGGGCCCTCTAA
Gene >OphauG2|7765
ATGAAGTGCGCCATCATCCTCGCCGCCGCTGTCGCCGCCATGGCCAGCGCCCTCCCCTCCGGCAACAAGCCACTC
CTCCCTTGGGTCAGCGACGAGGAGCGCTTCCTGCCTCATGAGTGCGGTCCGTTTGGCTATGACGAAAAGACTTGC
GGCACGCTCATTTACTGCGACGCCTTTGAGTCTGCCATCTTCAACAAGCCAACCGGCTATGCCAACACCCAGCAA
TGCCTTGACGCCCATGAGCCTGCGCCCATCCTGCCTTGGGTCGCAGCCCCCAACGTCTTCCGTCCCTCGTCTTGC
CAGGTTGGCTTGATTAGCGCCGAGTGCCCATTCGTTTGTGGGCTCTTTGGCACCTTCAACGACAAGTTGTGCGGC
ACCAAGCGCTACTGCGAGGCCTTTGACAAGGTCAAGCCCAAGCCTCTGGGCTATAAGAACACTGAGGAATGCTTC
AGGGCTCACCGGGCCCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail