Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7763
Gene name
LocationContig_94:7223..8489
Strand-
Gene length (bp)1266
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.8E-27 32 138
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 3.8E-18 181 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 8 341 2.0E-66
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 25 340 2.0E-61
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 8 341 5.0E-61
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1 338 8.0E-48
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 6 341 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 8 341 2.0E-66
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 25 340 2.0E-61
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 8 341 5.0E-61
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1 338 8.0E-48
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 6 341 1.0E-47
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 5 302 5.0E-47
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 1 338 1.0E-46
sp|Q40976|CADH_PINRA Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1 33 338 2.0E-46
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 5 338 3.0E-46
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 1 302 1.0E-45
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 1 338 4.0E-45
sp|Q08350|CADH7_PICAB Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 33 338 5.0E-45
sp|O82035|CADH2_PICAB Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 33 338 5.0E-45
sp|P9WQC5|ADHC_MYCTU NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 1 341 3.0E-44
sp|P9WQC4|ADHC_MYCTO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 1 341 3.0E-44
sp|P0A4X1|ADHC_MYCBO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 1 341 3.0E-44
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 8 315 3.0E-43
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 8 315 3.0E-43
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 1 338 9.0E-43
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 2 302 3.0E-42
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 1 338 6.0E-42
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 33 341 9.0E-42
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 1 338 2.0E-41
sp|P0CH37|ADHC2_MYCS2 NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 1 338 2.0E-41
sp|P0CH36|ADHC1_MYCS2 NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 1 338 2.0E-41
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 24 302 4.0E-41
sp|O45687|ADH2_CAEEL Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 6 338 8.0E-41
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 6 338 8.0E-41
sp|O00097|ADH1_PICST Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 1 338 8.0E-41
sp|P31656|CADH_MEDSA Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1 15 341 1.0E-40
sp|Q17334|ADH1_CAEEL Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 1 338 6.0E-39
sp|Q8NXU1|ADH_STAAW Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q6GBM4|ADH_STAAS Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q6GJ63|ADH_STAAR Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q5HI63|ADH_STAAC Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q2YSX0|ADH_STAAB Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q2G0G1|ADH_STAA8 Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q2FJ31|ADH_STAA3 Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 25 338 3.0E-38
sp|Q7A742|ADH_STAAN Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 25 338 4.0E-38
sp|Q99W07|ADH_STAAM Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 25 338 4.0E-38
sp|P48523|CADH4_ARATH Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana GN=CAD4 PE=1 SV=1 33 338 5.0E-38
sp|Q9P6C8|ADH1_NEUCR Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 9 338 6.0E-38
sp|P41637|CADH_PINTA Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1 33 338 2.0E-36
sp|P41747|ADH1_ASPFN Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 1 340 2.0E-36
sp|F2Z678|ADH2_YARLI Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 6 302 5.0E-36
sp|P00332|ADH_SCHPO Alcohol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh1 PE=1 SV=2 1 341 2.0E-35
sp|P39451|ADHP_ECOLI Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1 25 341 1.0E-34
sp|P07754|ADH3_EMENI Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 1 340 3.0E-34
sp|Q5HRD6|ADH_STAEQ Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 20 341 1.0E-33
sp|O64969|CADH_EUCGL Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 25 338 2.0E-33
sp|P31655|CADH2_EUCGU Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1 25 338 2.0E-33
sp|Q42726|CADH1_EUCGU Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1 25 338 2.0E-33
sp|Q8CQ56|ADH_STAES Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 20 341 1.0E-32
sp|P30359|CADH1_TOBAC Probable cinnamyl alcohol dehydrogenase 1 OS=Nicotiana tabacum GN=CAD14 PE=1 SV=1 33 338 1.0E-32
sp|P08843|ADH1_EMENI Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 1 340 2.0E-32
sp|O65621|CADH6_ARATH Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1 31 341 4.0E-32
sp|Q2R114|CADH4_ORYSJ Putative cinnamyl alcohol dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CAD4 PE=3 SV=2 33 341 6.0E-32
sp|O49482|CADH5_ARATH Cinnamyl alcohol dehydrogenase 5 OS=Arabidopsis thaliana GN=CAD5 PE=1 SV=1 33 341 7.0E-32
sp|Q9ZRF1|MTDH_FRAAN Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 31 340 2.0E-31
sp|Q96XE0|ADH_SULTO NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 8 339 2.0E-31
sp|Q337Y2|CADH3_ORYSJ Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 33 338 3.0E-31
sp|P20368|ADH1_ZYMMO Alcohol dehydrogenase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhA PE=1 SV=2 30 338 4.0E-31
sp|P30360|CADH2_TOBAC Probable cinnamyl alcohol dehydrogenase 2 OS=Nicotiana tabacum GN=CAD19 PE=1 SV=1 33 338 5.0E-31
sp|Q5UQG2|YL498_MIMIV Probable zinc-type alcohol dehydrogenase-like protein L498 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L498 PE=1 SV=1 27 341 5.0E-31
sp|P42495|CADH1_ARACO Probable cinnamyl alcohol dehydrogenase 1 OS=Aralia cordata GN=CAD1 PE=2 SV=1 33 338 5.0E-31
sp|Q8H859|CADH1_ORYSJ Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CAD1 PE=2 SV=1 30 341 6.0E-31
sp|P42754|MTDH_PETCR Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 31 338 1.0E-30
sp|P42734|CADH9_ARATH Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 31 338 3.0E-30
sp|Q9CAI3|CADH1_ARATH Probable cinnamyl alcohol dehydrogenase 1 OS=Arabidopsis thaliana GN=CAD1 PE=2 SV=1 33 341 3.0E-30
sp|Q02971|CADH7_ARATH Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2 31 338 3.0E-30
sp|P50746|CADH_EUCBO Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus botryoides GN=CAD1 PE=3 SV=1 25 338 4.0E-30
sp|P93257|MTDH_MESCR Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1 20 338 5.0E-30
sp|P31657|CADH_POPDE Probable cinnamyl alcohol dehydrogenase OS=Populus deltoides PE=2 SV=2 33 338 3.0E-29
sp|P27250|AHR_ECOLI Aldehyde reductase Ahr OS=Escherichia coli (strain K12) GN=ahr PE=1 SV=2 33 338 3.0E-29
sp|Q10PS6|CADH9_ORYSJ Probable cinnamyl alcohol dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CAD9 PE=2 SV=1 33 338 3.0E-29
sp|Q2KNL5|CADH1_OCIBA Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilicum GN=CAD1 PE=1 SV=1 15 338 4.0E-29
sp|Q4J781|ADH_SULAC NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=adh PE=3 SV=1 8 340 4.0E-29
sp|Q38707|MTDH_APIGR Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 31 340 3.0E-28
sp|Q2KNL6|GEDH1_OCIBA Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1 31 341 3.0E-28
sp|Q02972|CADH8_ARATH Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1 21 338 1.0E-27
sp|Q9SJ25|CADH2_ARATH Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 31 338 2.0E-27
sp|O22380|CADH_LOLPR Probable cinnamyl alcohol dehydrogenase OS=Lolium perenne PE=2 SV=1 33 338 2.0E-27
sp|P54202|ADH2_EMENI Alcohol dehydrogenase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcB PE=3 SV=2 8 340 2.0E-27
sp|O82515|MTDH_MEDSA Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 33 338 2.0E-27
sp|Q0JA75|CADH7_ORYSJ Cinnamyl alcohol dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CAD7 PE=2 SV=1 21 340 9.0E-27
sp|Q9SJ10|CADH3_ARATH Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 31 338 3.0E-26
sp|P75691|YAHK_ECOLI Aldehyde reductase YahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1 24 338 4.0E-26
sp|O82056|CADH_SACOF Probable cinnamyl alcohol dehydrogenase OS=Saccharum officinarum GN=CAD PE=2 SV=1 33 338 4.0E-26
sp|A4YGN0|SUCD_METS5 Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 8 325 6.0E-26
sp|Q6ZHS4|CADH2_ORYSJ Cinnamyl alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CAD2 PE=1 SV=1 33 338 7.0E-26
sp|Q0J6T3|CADH5_ORYSJ Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 33 340 1.0E-25
sp|P39462|ADH_SULSO NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 8 338 2.0E-25
sp|Q7XWU3|CADH6_ORYSJ Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 33 340 2.0E-25
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 9 292 4.0E-25
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 9 292 6.0E-25
sp|P50381|ADH_SULSR NAD-dependent alcohol dehydrogenase OS=Sulfolobus sp. (strain RC3) GN=adh PE=3 SV=1 8 338 6.0E-25
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 8 225 1.0E-24
sp|Q6ERW9|CAD8B_ORYSJ Probable cinnamyl alcohol dehydrogenase 8B OS=Oryza sativa subsp. japonica GN=CAD8B PE=3 SV=2 30 338 1.0E-24
sp|P9WQC1|ADHA_MYCTU Probable alcohol dehydrogenase AdhA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhA PE=1 SV=1 29 229 1.0E-24
sp|P9WQC0|ADHA_MYCTO Probable alcohol dehydrogenase AdhA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhA PE=3 SV=1 29 229 1.0E-24
sp|Q6ERX1|CAD8A_ORYSJ Probable cinnamyl alcohol dehydrogenase 8A OS=Oryza sativa subsp. japonica GN=CAD8A PE=2 SV=1 30 338 1.0E-24
sp|Q6ERW5|CAD8D_ORYSJ Probable cinnamyl alcohol dehydrogenase 8D OS=Oryza sativa subsp. japonica GN=CAD8D PE=2 SV=1 30 338 1.0E-24
sp|Q11L77|TDH_CHESB L-threonine 3-dehydrogenase OS=Chelativorans sp. (strain BNC1) GN=tdh PE=3 SV=1 3 265 3.0E-24
sp|Q43137|MTDH1_STYHU Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1 33 338 1.0E-23
sp|Q52998|TDH_RHIME L-threonine 3-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=tdh PE=3 SV=2 3 234 3.0E-23
sp|Q6V4H0|10HGO_CATRO 8-hydroxygeraniol dehydrogenase OS=Catharanthus roseus GN=10HGO PE=1 SV=1 31 338 3.0E-23
sp|P25377|ADH7_YEAST NADP-dependent alcohol dehydrogenase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH7 PE=1 SV=1 33 339 4.0E-23
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 9 292 6.0E-23
sp|A6UBM6|TDH_SINMW L-threonine 3-dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=tdh PE=3 SV=1 3 234 6.0E-23
sp|Q83F39|TDH_COXBU L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tdh PE=3 SV=1 14 331 1.0E-22
sp|A9NA21|TDH_COXBR L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tdh PE=3 SV=1 14 331 1.0E-22
sp|A9KET6|TDH_COXBN L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tdh PE=3 SV=1 14 331 1.0E-22
sp|B6J2S1|TDH_COXB2 L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain CbuG_Q212) GN=tdh PE=3 SV=1 14 331 1.0E-22
sp|C3MFH1|TDH_RHISN L-threonine 3-dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=tdh PE=3 SV=1 3 234 1.0E-22
sp|B6YTJ5|TDH_THEON Probable L-threonine 3-dehydrogenase OS=Thermococcus onnurineus (strain NA1) GN=tdh PE=3 SV=1 3 227 2.0E-22
sp|B5ZXE7|TDH_RHILW L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tdh PE=3 SV=1 3 234 2.0E-22
sp|Q1MDT5|TDH_RHIL3 L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tdh PE=3 SV=1 3 234 3.0E-22
sp|B9J738|TDH_AGRRK L-threonine 3-dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tdh PE=3 SV=1 3 234 3.0E-22
sp|Q2K618|TDH_RHIEC L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 3 234 4.0E-22
sp|O24562|CADH_MAIZE Probable cinnamyl alcohol dehydrogenase OS=Zea mays GN=CAD PE=2 SV=1 33 338 5.0E-22
sp|Q5QUN8|TDH_IDILO L-threonine 3-dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tdh PE=3 SV=1 14 287 3.0E-21
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 8 329 5.0E-21
sp|Q5JI69|TDH_THEKO Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 3 227 6.0E-21
sp|B3PUI4|TDH_RHIE6 L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=tdh PE=3 SV=1 3 234 6.0E-21
sp|Q6ERW7|CAD8C_ORYSJ Probable cinnamyl alcohol dehydrogenase 8C OS=Oryza sativa subsp. japonica GN=CAD8C PE=2 SV=2 30 338 8.0E-21
sp|Q07W50|TDH_SHEFN L-threonine 3-dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tdh PE=3 SV=1 23 287 3.0E-20
sp|B1KL24|TDH_SHEWM L-threonine 3-dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tdh PE=3 SV=1 24 287 4.0E-20
sp|A6W1W3|TDH_MARMS L-threonine 3-dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=tdh PE=3 SV=1 28 287 4.0E-20
sp|B2JPU0|TDH_BURP8 L-threonine 3-dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tdh PE=3 SV=1 20 287 6.0E-20
sp|Q6DAT5|TDH_PECAS L-threonine 3-dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tdh PE=3 SV=1 31 270 7.0E-20
sp|A4JKG7|TDH_BURVG L-threonine 3-dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tdh PE=3 SV=1 20 287 8.0E-20
sp|P73138|FRMA_SYNY3 S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=frmA PE=3 SV=1 8 225 1.0E-19
sp|Q3IHW0|TDH_PSEHT L-threonine 3-dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tdh PE=3 SV=1 31 287 1.0E-19
sp|Q8R7K0|TDH_CALS4 L-threonine 3-dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tdh PE=3 SV=2 24 277 1.0E-19
sp|Q63PD9|TDH_BURPS L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|A3NF91|TDH_BURP6 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|Q3JID4|TDH_BURP1 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|A3P139|TDH_BURP0 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|A1UXP8|TDH_BURMS L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|Q62EL5|TDH_BURMA L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|A2RZW5|TDH_BURM9 L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|A3MAC8|TDH_BURM7 L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=tdh PE=3 SV=1 16 233 2.0E-19
sp|B2T7X5|TDH_BURPP L-threonine 3-dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=tdh PE=3 SV=1 20 287 2.0E-19
sp|P9WQC7|ADHB_MYCTU Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 19 282 2.0E-19
sp|P9WQC6|ADHB_MYCTO Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 19 282 2.0E-19
sp|Q7U1B9|ADHB_MYCBO Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 19 282 2.0E-19
sp|A9AR24|TDH_BURM1 L-threonine 3-dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tdh PE=3 SV=1 20 287 2.0E-19
sp|Q04894|ADH6_YEAST NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH6 PE=1 SV=1 33 339 2.0E-19
sp|A4YCC5|TDH_SHEPC L-threonine 3-dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tdh PE=3 SV=1 24 234 2.0E-19
sp|A6WUG6|TDH_SHEB8 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS185) GN=tdh PE=3 SV=1 31 234 2.0E-19
sp|Q38ZS8|TDH_BURL3 L-threonine 3-dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tdh PE=3 SV=1 16 287 3.0E-19
sp|A1RE07|TDH_SHESW L-threonine 3-dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=tdh PE=3 SV=1 33 287 3.0E-19
sp|A4FND4|TDH_SACEN L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 8 287 4.0E-19
sp|Q8E8J1|TDH_SHEON L-threonine 3-dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=tdh PE=3 SV=1 24 287 4.0E-19
sp|Q2T9E1|TDH_BURTA L-threonine 3-dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tdh PE=3 SV=1 16 233 5.0E-19
sp|B4EFZ7|TDH_BURCJ L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tdh PE=3 SV=1 16 287 5.0E-19
sp|C6DIA7|TDH_PECCP L-threonine 3-dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tdh PE=3 SV=1 31 270 5.0E-19
sp|Q13SG2|TDH_BURXL L-threonine 3-dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=tdh PE=3 SV=1 20 287 5.0E-19
sp|A9KWY0|TDH_SHEB9 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS195) GN=tdh PE=3 SV=1 33 234 5.0E-19
sp|A3CYN0|TDH_SHEB5 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tdh PE=3 SV=1 33 234 5.0E-19
sp|B8EDS6|TDH_SHEB2 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS223) GN=tdh PE=3 SV=1 33 234 5.0E-19
sp|A0B459|TDH_BURCH L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=tdh PE=3 SV=1 16 287 5.0E-19
sp|B1K269|TDH_BURCC L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=tdh PE=3 SV=1 16 287 5.0E-19
sp|Q1BK24|TDH_BURCA L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=tdh PE=3 SV=1 16 287 5.0E-19
sp|A3QJC8|TDH_SHELP L-threonine 3-dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tdh PE=3 SV=1 33 287 6.0E-19
sp|Q0HPI5|TDH_SHESR L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-7) GN=tdh PE=3 SV=1 24 287 6.0E-19
sp|Q0V7W6|ADHL5_ARATH Alcohol dehydrogenase-like 5 OS=Arabidopsis thaliana GN=At4g22110 PE=2 SV=1 8 265 7.0E-19
sp|Q0HDA3|TDH_SHESM L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-4) GN=tdh PE=3 SV=1 24 287 1.0E-18
sp|A0L2Q3|TDH_SHESA L-threonine 3-dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=tdh PE=3 SV=1 24 287 1.0E-18
sp|Q15ZU4|TDH_PSEA6 L-threonine 3-dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tdh PE=3 SV=1 27 234 1.0E-18
sp|B4F134|TDH_PROMH L-threonine 3-dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=tdh PE=3 SV=1 14 329 1.0E-18
sp|A8GYP8|TDH_SHEPA L-threonine 3-dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tdh PE=3 SV=1 33 287 1.0E-18
sp|Q0B5Q1|TDH_BURCM L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tdh PE=3 SV=1 16 287 2.0E-18
sp|Q983J7|TDH_RHILO L-threonine 3-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=tdh PE=3 SV=1 3 234 2.0E-18
sp|Q9RTU4|TDH_DEIRA L-threonine 3-dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tdh PE=3 SV=2 8 265 2.0E-18
sp|A1S1Q3|TDH_SHEAM L-threonine 3-dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tdh PE=3 SV=1 24 234 2.0E-18
sp|B1YXP0|TDH_BURA4 L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=tdh PE=3 SV=1 16 287 2.0E-18
sp|B4S298|TDH_ALTMD L-threonine 3-dehydrogenase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tdh PE=3 SV=1 33 287 3.0E-18
sp|A8ARK6|TDH_CITK8 L-threonine 3-dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tdh PE=3 SV=1 21 234 3.0E-18
sp|A4SHB7|TDH_AERS4 L-threonine 3-dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=tdh PE=3 SV=1 31 234 4.0E-18
sp|Q9L233|TDH_STRCO L-threonine 3-dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tdh PE=3 SV=1 14 307 4.0E-18
sp|B1JQW2|TDH_YERPY L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tdh PE=3 SV=1 31 331 4.0E-18
sp|Q66GC5|TDH_YERPS L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tdh PE=3 SV=1 31 331 4.0E-18
sp|B2JYP4|TDH_YERPB L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tdh PE=3 SV=1 31 331 4.0E-18
sp|A7FCU5|TDH_YERP3 L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tdh PE=3 SV=1 31 331 4.0E-18
sp|P80175|ADHN_AMYME NDMA-dependent alcohol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 8 217 4.0E-18
sp|Q06004|DHSO_BACSU Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 33 331 5.0E-18
sp|A4TSC6|TDH_YERPP L-threonine 3-dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=tdh PE=3 SV=1 33 331 5.0E-18
sp|Q1CD13|TDH_YERPN L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tdh PE=3 SV=1 33 331 5.0E-18
sp|A9R685|TDH_YERPG L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tdh PE=3 SV=1 33 331 5.0E-18
sp|Q8ZJN2|TDH_YERPE L-threonine 3-dehydrogenase OS=Yersinia pestis GN=tdh PE=3 SV=1 33 331 5.0E-18
sp|Q1C278|TDH_YERPA L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tdh PE=3 SV=1 33 331 5.0E-18
sp|P9WQB9|ADHD_MYCTU Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhD PE=1 SV=1 9 264 5.0E-18
sp|P9WQB8|ADHD_MYCTO Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhD PE=3 SV=1 9 264 5.0E-18
sp|Q9SK86|ADHL1_ARATH Alcohol dehydrogenase-like 1 OS=Arabidopsis thaliana GN=At1g22430 PE=2 SV=1 6 220 6.0E-18
sp|Q48AM4|TDH_COLP3 L-threonine 3-dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tdh PE=3 SV=1 27 287 8.0E-18
sp|Q43138|MTDH3_STYHU Probable mannitol dehydrogenase 3 OS=Stylosanthes humilis GN=CAD3 PE=2 SV=1 31 340 1.0E-17
sp|A5IGK7|TDH_LEGPC L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Corby) GN=tdh PE=3 SV=1 33 329 1.0E-17
sp|B0TNM4|TDH_SHEHH L-threonine 3-dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tdh PE=3 SV=1 33 287 1.0E-17
sp|Q5ZXM9|TDH_LEGPH L-threonine 3-dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tdh PE=3 SV=2 33 329 1.0E-17
sp|P59410|TDH_VIBPA L-threonine 3-dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tdh PE=3 SV=1 14 287 1.0E-17
sp|C1D195|TDH_DEIDV L-threonine 3-dehydrogenase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tdh PE=3 SV=1 21 287 2.0E-17
sp|Q5X748|TDH_LEGPA L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Paris) GN=tdh PE=3 SV=1 33 329 2.0E-17
sp|Q82MN2|TDH_STRAW L-threonine 3-dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tdh PE=3 SV=1 8 307 2.0E-17
sp|A8GLC6|TDH_SERP5 L-threonine 3-dehydrogenase OS=Serratia proteamaculans (strain 568) GN=tdh PE=3 SV=1 33 287 2.0E-17
sp|A9MKQ8|TDH_SALAR L-threonine 3-dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tdh PE=3 SV=1 33 287 2.0E-17
sp|A1SVW5|TDH_PSYIN L-threonine 3-dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=tdh PE=3 SV=1 14 331 3.0E-17
sp|Q72L62|TDH_THET2 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tdh PE=3 SV=1 8 236 3.0E-17
sp|A8FPE0|TDH_SHESH L-threonine 3-dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=tdh PE=3 SV=1 24 279 3.0E-17
sp|P07913|TDH_ECOLI L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12) GN=tdh PE=1 SV=1 21 234 3.0E-17
sp|B1X950|TDH_ECODH L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=tdh PE=3 SV=1 21 234 3.0E-17
sp|C4ZXK8|TDH_ECOBW L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tdh PE=3 SV=1 21 234 3.0E-17
sp|Q3YVY1|TDH_SHISS L-threonine 3-dehydrogenase OS=Shigella sonnei (strain Ss046) GN=tdh PE=3 SV=1 21 237 4.0E-17
sp|Q5E0F9|TDH_VIBF1 L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tdh PE=3 SV=1 25 287 4.0E-17
sp|Q5WYJ7|TDH_LEGPL L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Lens) GN=tdh PE=3 SV=1 33 329 4.0E-17
sp|A0KQV6|TDH_AERHH L-threonine 3-dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tdh PE=3 SV=1 33 234 5.0E-17
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 3 237 5.0E-17
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 29 302 5.0E-17
sp|Q6LRD9|TDH_PHOPR L-threonine 3-dehydrogenase OS=Photobacterium profundum GN=tdh PE=3 SV=2 25 287 6.0E-17
sp|B7NES3|TDH_ECOLU L-threonine 3-dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tdh PE=3 SV=1 21 234 6.0E-17
sp|B5XTI4|TDH_KLEP3 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=tdh PE=3 SV=1 33 234 6.0E-17
sp|A6TFL2|TDH_KLEP7 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tdh PE=3 SV=1 33 234 7.0E-17
sp|B7LVH6|TDH_ESCF3 L-threonine 3-dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tdh PE=3 SV=1 33 234 7.0E-17
sp|Q1R4X4|TDH_ECOUT L-threonine 3-dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|B1LK55|TDH_ECOSM L-threonine 3-dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|Q8FCA2|TDH_ECOL6 L-threonine 3-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|A1AHF3|TDH_ECOK1 L-threonine 3-dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|B7N1S0|TDH_ECO81 L-threonine 3-dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|B7NPC5|TDH_ECO7I L-threonine 3-dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|B7MFI0|TDH_ECO45 L-threonine 3-dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|B7ULH2|TDH_ECO27 L-threonine 3-dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tdh PE=3 SV=1 21 234 7.0E-17
sp|A1JHX8|TDH_YERE8 L-threonine 3-dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tdh PE=3 SV=1 25 234 8.0E-17
sp|B5YWB7|TDH_ECO5E L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|Q8XEJ1|TDH_ECO57 L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|B4UMJ1|TDH_ANASK L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain K) GN=tdh PE=3 SV=1 33 234 8.0E-17
sp|P59409|TDH_SHIFL L-threonine 3-dehydrogenase OS=Shigella flexneri GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|Q0SYE5|TDH_SHIF8 L-threonine 3-dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|Q31V06|TDH_SHIBS L-threonine 3-dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|B2U5D5|TDH_SHIB3 L-threonine 3-dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|B6I3J6|TDH_ECOSE L-threonine 3-dehydrogenase OS=Escherichia coli (strain SE11) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|B1IZH4|TDH_ECOLC L-threonine 3-dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|Q0TBJ0|TDH_ECOL5 L-threonine 3-dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|A8A681|TDH_ECOHS L-threonine 3-dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|B7M4A3|TDH_ECO8A L-threonine 3-dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|B7L742|TDH_ECO55 L-threonine 3-dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=tdh PE=3 SV=1 21 234 8.0E-17
sp|Q67N85|TDH_SYMTH L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 3 249 8.0E-17
sp|Q8ZL52|TDH_SALTY L-threonine 3-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B4TZV9|TDH_SALSV L-threonine 3-dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B5BHZ1|TDH_SALPK L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|C0Q1V0|TDH_SALPC L-threonine 3-dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|A9MVL0|TDH_SALPB L-threonine 3-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|Q5PC07|TDH_SALPA L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B4SXB9|TDH_SALNS L-threonine 3-dehydrogenase OS=Salmonella newport (strain SL254) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B4T9A1|TDH_SALHS L-threonine 3-dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B5R5E1|TDH_SALEP L-threonine 3-dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B5FLI6|TDH_SALDC L-threonine 3-dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|Q57IC5|TDH_SALCH L-threonine 3-dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|B5EXC3|TDH_SALA4 L-threonine 3-dehydrogenase OS=Salmonella agona (strain SL483) GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|Q8Z2F4|TDH_SALTI L-threonine 3-dehydrogenase OS=Salmonella typhi GN=tdh PE=3 SV=1 33 287 9.0E-17
sp|P80094|FADH_AMYME S-(hydroxymethyl)mycothiol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 6 235 1.0E-16
sp|A7ZTH0|TDH_ECO24 L-threonine 3-dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tdh PE=3 SV=1 21 234 1.0E-16
sp|B5ETJ6|TDH_VIBFM L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=tdh PE=3 SV=1 25 287 1.0E-16
sp|Q5SKS4|TDH_THET8 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tdh PE=1 SV=1 8 236 1.0E-16
sp|B5RGH0|TDH_SALG2 L-threonine 3-dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tdh PE=3 SV=1 33 234 1.0E-16
sp|B7VR52|TDH_VIBTL L-threonine 3-dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=tdh PE=3 SV=1 25 287 1.0E-16
sp|B8J714|TDH_ANAD2 L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tdh PE=3 SV=1 19 234 1.0E-16
sp|A7HEI5|TDH_ANADF L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tdh PE=3 SV=1 62 234 2.0E-16
sp|A7MID0|TDH_CROS8 L-threonine 3-dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tdh PE=3 SV=1 14 234 2.0E-16
sp|C5BB99|TDH_EDWI9 L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 21 234 2.0E-16
sp|Q2IJN4|TDH_ANADE L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tdh PE=3 SV=1 19 234 2.0E-16
sp|B6ESA4|TDH_ALISL L-threonine 3-dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=tdh PE=3 SV=1 25 287 3.0E-16
sp|Q7MY48|TDH_PHOLL L-threonine 3-dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tdh PE=3 SV=1 24 234 3.0E-16
sp|Q7NXH5|TDH_CHRVO L-threonine 3-dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tdh PE=3 SV=1 15 287 4.0E-16
sp|C3LWF0|TDH_VIBCM L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tdh PE=3 SV=1 14 234 5.0E-16
sp|Q9KL62|TDH_VIBCH L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tdh PE=3 SV=1 14 234 5.0E-16
sp|A5F0N6|TDH_VIBC3 L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tdh PE=3 SV=1 14 234 5.0E-16
sp|Q329N8|TDH_SHIDS L-threonine 3-dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tdh PE=3 SV=1 21 234 6.0E-16
sp|A4W529|TDH_ENT38 L-threonine 3-dehydrogenase OS=Enterobacter sp. (strain 638) GN=tdh PE=3 SV=1 33 234 6.0E-16
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 32 224 1.0E-15
sp|Q57517|Y053_HAEIN Uncharacterized zinc-type alcohol dehydrogenase-like protein HI_0053 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0053 PE=3 SV=1 5 238 3.0E-15
sp|Q8D442|TDH_VIBVU L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=tdh PE=3 SV=1 33 287 3.0E-15
sp|P39849|XYLB_PSEPU Aryl-alcohol dehydrogenase OS=Pseudomonas putida GN=xylB PE=1 SV=1 8 336 4.0E-15
sp|Q7MFL5|TDH_VIBVY L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=tdh PE=3 SV=1 33 287 5.0E-15
sp|A4IZ92|TDH_FRATW L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tdh PE=3 SV=1 14 232 5.0E-15
sp|Q5NGW4|TDH_FRATT L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tdh PE=3 SV=1 14 232 5.0E-15
sp|Q14IB6|TDH_FRAT1 L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tdh PE=3 SV=1 14 232 5.0E-15
sp|Q0BKV5|TDH_FRATO L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tdh PE=3 SV=1 14 232 5.0E-15
sp|Q2A282|TDH_FRATH L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tdh PE=3 SV=1 14 232 5.0E-15
sp|A7NDM9|TDH_FRATF L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tdh PE=3 SV=1 14 232 5.0E-15
sp|A0Q5K3|TDH_FRATN L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. novicida (strain U112) GN=tdh PE=3 SV=1 14 232 6.0E-15
sp|P77539|YDJL_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjL OS=Escherichia coli (strain K12) GN=ydjL PE=3 SV=1 64 282 9.0E-15
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 3 327 9.0E-15
sp|P38105|RSPB_ECOLI Starvation-sensing protein RspB OS=Escherichia coli (strain K12) GN=rspB PE=2 SV=1 8 265 1.0E-14
sp|Q5GWI3|TDH_XANOR L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tdh PE=3 SV=2 21 233 1.0E-14
sp|Q2NZP2|TDH_XANOM L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tdh PE=3 SV=1 21 233 1.0E-14
sp|Q8VZ49|ADHL4_ARATH Alcohol dehydrogenase-like 4 OS=Arabidopsis thaliana GN=At1g64710 PE=2 SV=1 4 225 1.0E-14
sp|B2SDJ2|TDH_FRATM L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tdh PE=3 SV=1 14 232 1.0E-14
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 23 237 2.0E-14
sp|B1VWE7|TDH_STRGG L-threonine 3-dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=tdh PE=3 SV=1 24 289 2.0E-14
sp|Q3BWT0|TDH_XANC5 L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tdh PE=3 SV=1 21 233 2.0E-14
sp|P25406|ADH1B_SAAHA Alcohol dehydrogenase 1B OS=Saara hardwickii PE=1 SV=2 8 220 2.0E-14
sp|P79896|ADHX_SPAAU Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1 8 340 2.0E-14
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 3 327 2.0E-14
sp|P77280|YDJJ_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ OS=Escherichia coli (strain K12) GN=ydjJ PE=3 SV=1 11 326 3.0E-14
sp|O34268|TDH_XANCP L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tdh PE=3 SV=1 21 233 3.0E-14
sp|B0RU31|TDH_XANCB L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tdh PE=3 SV=1 21 233 3.0E-14
sp|Q4URI9|TDH_XANC8 L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tdh PE=3 SV=1 21 233 3.0E-14
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 3 237 3.0E-14
sp|A1L4Y2|ADHL3_ARATH Alcohol dehydrogenase-like 3 OS=Arabidopsis thaliana GN=At1g32780 PE=2 SV=1 4 220 3.0E-14
sp|H1ZV38|GEOA_CASDE Geraniol dehydrogenase OS=Castellaniella defragrans GN=geoA PE=1 SV=1 6 285 3.0E-14
sp|P77360|YPHC_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC OS=Escherichia coli (strain K12) GN=yphC PE=3 SV=2 21 331 4.0E-14
sp|B0TYR8|TDH_FRAP2 L-threonine 3-dehydrogenase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tdh PE=3 SV=1 14 222 4.0E-14
sp|Q8PNN2|TDH_XANAC L-threonine 3-dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tdh PE=3 SV=1 21 233 5.0E-14
sp|O74540|FADH2_SCHPO Putative S-(hydroxymethyl)glutathione dehydrogenase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.04c PE=3 SV=2 8 220 5.0E-14
sp|P39450|FRMA_PHODP S-(hydroxymethyl)glutathione dehydrogenase OS=Photobacterium damsela subsp. piscicida GN=frmA PE=3 SV=1 8 234 7.0E-14
sp|B2FQN4|TDH_STRMK L-threonine 3-dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=tdh PE=3 SV=1 21 233 7.0E-14
sp|B2NI93|GEDH_CARLC Geraniol dehydrogenase OS=Carpoglyphus lactis GN=gedh PE=1 SV=2 8 274 7.0E-14
sp|Q6AAR3|TDH_PROAC L-threonine 3-dehydrogenase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tdh PE=3 SV=1 8 287 9.0E-14
sp|P41681|ADH6_PERMA Alcohol dehydrogenase 6 OS=Peromyscus maniculatus GN=ADH6 PE=2 SV=1 8 220 9.0E-14
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 3 237 1.0E-13
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 3 239 1.0E-13
sp|P12886|ADH1_PEA Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1 8 323 2.0E-13
sp|Q6MD15|TDH_PARUW L-threonine 3-dehydrogenase OS=Protochlamydia amoebophila (strain UWE25) GN=tdh PE=3 SV=1 27 234 2.0E-13
sp|Q4R0J7|ARD1_UROFA D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 33 233 2.0E-13
sp|Q1RFI7|FRMA_ECOUT S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=frmA PE=3 SV=1 8 225 3.0E-13
sp|Q0TKS7|FRMA_ECOL5 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=frmA PE=3 SV=1 8 225 3.0E-13
sp|A1A835|FRMA_ECOK1 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=frmA PE=3 SV=1 8 225 3.0E-13
sp|P81601|ADHL_GADMO Alcohol dehydrogenase class-3 chain L OS=Gadus morhua PE=1 SV=1 8 220 3.0E-13
sp|P0A9S3|GATD_ECOLI Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=gatD PE=1 SV=1 8 222 4.0E-13
sp|P0A9S4|GATD_ECO57 Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli O157:H7 GN=gatD PE=3 SV=1 8 222 4.0E-13
sp|Q65JE7|TDH_BACLD L-threonine 3-dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tdh PE=3 SV=1 14 277 4.0E-13
sp|P80360|ADHX_MYXGL Alcohol dehydrogenase class-3 OS=Myxine glutinosa PE=1 SV=1 20 225 5.0E-13
sp|A7Z4X0|TDH_BACMF L-threonine 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tdh PE=3 SV=1 8 255 5.0E-13
sp|Q9FH04|ADHL7_ARATH Alcohol dehydrogenase-like 7 OS=Arabidopsis thaliana GN=At5g42250 PE=2 SV=1 8 323 5.0E-13
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 3 239 7.0E-13
sp|P25437|FRMA_ECOLI S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain K12) GN=frmA PE=1 SV=3 8 225 7.0E-13
sp|Q3Z550|FRMA_SHISS S-(hydroxymethyl)glutathione dehydrogenase OS=Shigella sonnei (strain Ss046) GN=frmA PE=3 SV=1 8 225 8.0E-13
sp|B1J085|FRMA_ECOLC S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=frmA PE=3 SV=1 8 225 8.0E-13
sp|A7ZX04|FRMA_ECOHS S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=frmA PE=3 SV=1 8 225 8.0E-13
sp|Q8X5J4|FRMA_ECO57 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O157:H7 GN=frmA PE=3 SV=1 8 225 8.0E-13
sp|A7ZIA4|FRMA_ECO24 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=frmA PE=3 SV=1 8 225 8.0E-13
sp|Q8FKG1|FRMA_ECOL6 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=frmA PE=3 SV=1 8 225 9.0E-13
sp|Q96533|ADHX_ARATH Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2 4 225 9.0E-13
sp|P0CL53|FADH_ASPOR S-(hydroxymethyl)glutathione dehydrogenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=FDH1 PE=3 SV=1 20 230 1.0E-12
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 24 263 1.0E-12
sp|Q9SK87|ADHL2_ARATH Alcohol dehydrogenase-like 2 OS=Arabidopsis thaliana GN=At1g22440 PE=2 SV=1 8 235 1.0E-12
sp|Q53U21|DOIAD_STRFR 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces fradiae GN=neoA PE=1 SV=1 8 214 1.0E-12
sp|Q3ZC42|ADHX_BOVIN Alcohol dehydrogenase class-3 OS=Bos taurus GN=ADH5 PE=2 SV=1 8 220 2.0E-12
sp|P32771|FADH_YEAST S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFA1 PE=1 SV=1 20 220 2.0E-12
sp|P13603|ADH1_TRIRP Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH1 PE=2 SV=1 8 323 2.0E-12
sp|Q06099|FADH_CANMA S-(hydroxymethyl)glutathione dehydrogenase OS=Candida maltosa GN=FDH1 PE=3 SV=1 14 233 3.0E-12
sp|Q2MFP3|DOIAD_STRRY 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces rimosus subsp. paromomycinus GN=parE PE=3 SV=1 21 232 3.0E-12
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 29 237 3.0E-12
sp|Q6L743|DOIAD_STRKN 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces kanamyceticus GN=kanE PE=3 SV=1 8 221 3.0E-12
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 6 291 3.0E-12
sp|P22797|ADH1_PELPE Alcohol dehydrogenase 1 OS=Pelophylax perezi PE=1 SV=1 8 340 3.0E-12
sp|Q4R0W1|DOIAD_STRRI 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces ribosidificus GN=rbmC PE=3 SV=1 8 286 4.0E-12
sp|O57380|ADH8_PELPE NADP-dependent alcohol dehydrogenase OS=Pelophylax perezi GN=ADH8 PE=1 SV=3 6 225 4.0E-12
sp|B1LIP1|FRMA_ECOSM S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmA PE=3 SV=1 8 225 5.0E-12
sp|Q5R7Z8|ADH6_PONAB Alcohol dehydrogenase 6 OS=Pongo abelii GN=ADH6 PE=2 SV=1 8 220 5.0E-12
sp|P81600|ADHH_GADMO Alcohol dehydrogenase class-3 chain H OS=Gadus morhua PE=1 SV=1 8 340 5.0E-12
sp|P80467|ADHX_SAAHA Alcohol dehydrogenase class-3 OS=Saara hardwickii PE=1 SV=1 8 338 5.0E-12
sp|Q2MF72|DOIAD_STRLV 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces lividus GN=livE PE=3 SV=1 8 201 5.0E-12
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 7 341 7.0E-12
sp|P39400|LGOD_ECOLI L-galactonate-5-dehydrogenase OS=Escherichia coli (strain K12) GN=lgoD PE=1 SV=3 23 242 8.0E-12
sp|Q54TC2|ADHX_DICDI Alcohol dehydrogenase class-3 OS=Dictyostelium discoideum GN=adh5 PE=3 SV=1 21 222 1.0E-11
sp|P93243|AHNL_LINUS Aliphatic (R)-hydroxynitrile lyase OS=Linum usitatissimum PE=1 SV=1 15 221 1.0E-11
sp|O31776|TDH_BACSU L-threonine 3-dehydrogenase OS=Bacillus subtilis (strain 168) GN=tdh PE=3 SV=1 21 329 1.0E-11
sp|P80572|ADHX_PEA Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1 4 220 1.0E-11
sp|P44557|FRMA_HAEIN S-(hydroxymethyl)glutathione dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frmA PE=3 SV=1 8 225 2.0E-11
sp|P86883|ADH1_COLLI Alcohol dehydrogenase 1 OS=Columba livia GN=ADH1 PE=1 SV=1 8 220 2.0E-11
sp|Q8LEB2|ADHL6_ARATH Alcohol dehydrogenase-like 6 OS=Arabidopsis thaliana GN=At5g24760 PE=2 SV=2 4 222 2.0E-11
sp|P28332|ADH6_HUMAN Alcohol dehydrogenase 6 OS=Homo sapiens GN=ADH6 PE=1 SV=2 8 220 2.0E-11
sp|P04707|ADH2_MAIZE Alcohol dehydrogenase 2 OS=Zea mays GN=ADH2 PE=2 SV=1 8 225 3.0E-11
sp|P80338|ADH1_STRCA Alcohol dehydrogenase 1 OS=Struthio camelus GN=ADH1 PE=1 SV=1 8 220 4.0E-11
sp|O19053|ADHX_RABIT Alcohol dehydrogenase class-3 OS=Oryctolagus cuniculus GN=ADH5 PE=2 SV=3 8 220 4.0E-11
sp|Q0ITW7|ADH2_ORYSJ Alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=ADH2 PE=2 SV=2 8 220 5.0E-11
sp|Q4R1E8|ADH2_ORYSI Alcohol dehydrogenase 2 OS=Oryza sativa subsp. indica GN=ADH2 PE=2 SV=1 8 220 5.0E-11
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 7 341 5.0E-11
sp|P80222|ADH1_ALLMI Alcohol dehydrogenase 1 OS=Alligator mississippiensis PE=1 SV=1 19 340 6.0E-11
sp|P19854|ADHX_HORSE Alcohol dehydrogenase class-3 OS=Equus caballus GN=ADH5 PE=1 SV=2 8 220 7.0E-11
sp|Q5LN53|TDH_RUEPO L-threonine 3-dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tdh PE=3 SV=2 8 287 1.0E-10
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 33 338 1.0E-10
sp|P12711|ADHX_RAT Alcohol dehydrogenase class-3 OS=Rattus norvegicus GN=Adh5 PE=1 SV=2 8 220 1.0E-10
sp|P80512|ADH1_NAJNA Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1 12 338 1.0E-10
sp|O35045|YJMD_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 18 235 1.0E-10
sp|P48977|ADH_MALDO Alcohol dehydrogenase OS=Malus domestica GN=ADH PE=2 SV=1 8 325 1.0E-10
sp|P78870|FADH1_SCHPO Probable S-(hydroxymethyl)glutathione dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.07c PE=2 SV=2 14 222 2.0E-10
sp|P80468|ADH4_STRCA Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH4 PE=1 SV=1 8 338 2.0E-10
sp|Q2MF22|DOIAD_STRSD 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tobE PE=3 SV=1 29 247 2.0E-10
sp|Q0W5A6|GLCDH_METAR Glucose 1-dehydrogenase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=gdh PE=3 SV=1 15 265 2.0E-10
sp|Q03505|ADH1_RABIT Alcohol dehydrogenase 1 OS=Oryctolagus cuniculus GN=ADH1 PE=1 SV=2 12 220 2.0E-10
sp|P46415|ADHX_DROME Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3 14 229 2.0E-10
sp|O74685|FADH_PICPA S-(hydroxymethyl)glutathione dehydrogenase OS=Komagataella pastoris GN=FLD1 PE=3 SV=1 8 230 3.0E-10
sp|P28474|ADHX_MOUSE Alcohol dehydrogenase class-3 OS=Mus musculus GN=Adh5 PE=1 SV=3 8 220 4.0E-10
sp|Q02912|DHSO_BOMMO Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 21 329 4.0E-10
sp|P86885|ADH1_MESAU Alcohol dehydrogenase 1 OS=Mesocricetus auratus GN=ADH1 PE=1 SV=1 8 220 4.0E-10
sp|Q5XI95|ADH6_RAT Alcohol dehydrogenase 6 OS=Rattus norvegicus GN=Adh6 PE=2 SV=1 8 228 4.0E-10
sp|P47734|FADH_METMR S-(hydroxymethyl)glutathione dehydrogenase OS=Methylobacter marinus GN=fdh PE=3 SV=2 33 256 5.0E-10
sp|P93629|ADHX_MAIZE Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1 4 225 5.0E-10
sp|P00326|ADH1G_HUMAN Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C PE=1 SV=2 12 220 6.0E-10
sp|P22144|XYL2_PICST D-xylulose reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=XYL2 PE=2 SV=1 33 235 7.0E-10
sp|P08319|ADH4_HUMAN Alcohol dehydrogenase 4 OS=Homo sapiens GN=ADH4 PE=1 SV=5 14 234 8.0E-10
sp|P00325|ADH1B_HUMAN Alcohol dehydrogenase 1B OS=Homo sapiens GN=ADH1B PE=1 SV=2 8 220 9.0E-10
sp|P07327|ADH1A_HUMAN Alcohol dehydrogenase 1A OS=Homo sapiens GN=ADH1A PE=1 SV=2 12 220 9.0E-10
sp|P19631|ADH1_COTJA Alcohol dehydrogenase 1 OS=Coturnix coturnix japonica GN=ADH1 PE=1 SV=1 8 220 1.0E-09
sp|O46649|ADHP_RABIT Alcohol dehydrogenase class-2 isozyme 1 OS=Oryctolagus cuniculus GN=ADH2-1 PE=2 SV=2 8 338 1.0E-09
sp|P41680|ADH1_PERMA Alcohol dehydrogenase 1 OS=Peromyscus maniculatus GN=ADH1 PE=2 SV=2 8 220 1.0E-09
sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4 8 220 1.0E-09
sp|Q5R1W2|ADH1B_PANTR Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH1B PE=2 SV=3 8 220 2.0E-09
sp|P06525|ADH1_ARATH Alcohol dehydrogenase class-P OS=Arabidopsis thaliana GN=ADH1 PE=1 SV=2 8 340 2.0E-09
sp|Q64563|ADH4_RAT Alcohol dehydrogenase 4 OS=Rattus norvegicus GN=Adh4 PE=2 SV=3 13 340 2.0E-09
sp|A2XAZ3|ADHX_ORYSI Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1 4 225 2.0E-09
sp|Q0DWH1|ADHX_ORYSJ Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1 14 225 3.0E-09
sp|P23991|ADH1_CHICK Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 PE=1 SV=2 8 220 3.0E-09
sp|P25405|ADH1A_SAAHA Alcohol dehydrogenase 1A OS=Saara hardwickii PE=1 SV=2 20 220 3.0E-09
sp|O97959|ADH1G_PAPHA Alcohol dehydrogenase 1C OS=Papio hamadryas GN=ADH1C PE=2 SV=3 8 220 3.0E-09
sp|P14139|ADH1B_PAPHA Alcohol dehydrogenase 1B OS=Papio hamadryas GN=ADH1B PE=2 SV=2 8 220 4.0E-09
sp|P26325|ADH1_GADMC Alcohol dehydrogenase 1 OS=Gadus morhua subsp. callarias PE=1 SV=1 21 222 4.0E-09
sp|P28469|ADH1A_MACMU Alcohol dehydrogenase 1A OS=Macaca mulatta GN=ADH1A PE=2 SV=2 19 220 4.0E-09
sp|Q0KDL6|ADH_CUPNH Alcohol dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adh PE=1 SV=1 8 268 5.0E-09
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 29 239 5.0E-09
sp|Q70KF0|DOIAD_MICEC 2-deoxy-scyllo-inosamine dehydrogenase OS=Micromonospora echinospora GN=gacH PE=3 SV=1 32 222 5.0E-09
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 30 228 6.0E-09
sp|P10847|ADH2_HORVU Alcohol dehydrogenase 2 OS=Hordeum vulgare GN=ADH2 PE=3 SV=1 8 220 7.0E-09
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 28 239 7.0E-09
sp|P14675|ADH3_SOLTU Alcohol dehydrogenase 3 OS=Solanum tuberosum GN=ADH3 PE=2 SV=1 8 220 7.0E-09
sp|P14674|ADH2_SOLTU Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=ADH2 PE=2 SV=1 8 220 8.0E-09
sp|P49645|ADH1_APTAU Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 8 220 9.0E-09
sp|Q5RBP7|ADH1A_PONAB Alcohol dehydrogenase 1A OS=Pongo abelii GN=ADH1A PE=2 SV=3 12 220 9.0E-09
sp|P14940|ADH_CUPNE Alcohol dehydrogenase OS=Cupriavidus necator GN=adh PE=3 SV=1 8 268 1.0E-08
sp|Q17335|ADHX_CAEEL Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1 20 226 1.0E-08
sp|P72324|ADHI_RHOS4 Alcohol dehydrogenase class-3 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=adhI PE=3 SV=1 8 225 1.0E-08
sp|P28032|ADH2_SOLLC Alcohol dehydrogenase 2 OS=Solanum lycopersicum GN=ADH2 PE=2 SV=2 8 323 1.0E-08
sp|P45382|FADH_PARDE S-(hydroxymethyl)glutathione dehydrogenase OS=Paracoccus denitrificans GN=flhA PE=1 SV=1 8 233 1.0E-08
sp|C5FTT1|XYL2_ARTOC Probable D-xylulose reductase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xdhA PE=3 SV=1 33 233 1.0E-08
sp|P14673|ADH1_SOLTU Alcohol dehydrogenase 1 OS=Solanum tuberosum GN=ADH1 PE=2 SV=1 8 220 1.0E-08
sp|P06757|ADH1_RAT Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Adh1 PE=1 SV=3 8 220 2.0E-08
sp|Q02BT1|TDH_SOLUE L-threonine 3-dehydrogenase OS=Solibacter usitatus (strain Ellin6076) GN=tdh PE=3 SV=1 33 234 2.0E-08
sp|F0QYK7|GLCD2_VULM7 Glucose 1-dehydrogenase 2 OS=Vulcanisaeta moutnovskia (strain 768-28) GN=gdh2 PE=3 SV=2 21 230 2.0E-08
sp|Q5ARL6|XYL2_EMENI Probable D-xylulose reductase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xdhA PE=3 SV=1 33 233 2.0E-08
sp|P39713|BDH2_YEAST Probable diacetyl reductase [(R)-acetoin forming] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH2 PE=1 SV=1 33 266 3.0E-08
sp|F0QUB3|GLCD1_VULM7 Glucose 1-dehydrogenase 1 OS=Vulcanisaeta moutnovskia (strain 768-28) GN=gdh1 PE=3 SV=1 29 313 5.0E-08
sp|P81431|ADHX_OCTVU Alcohol dehydrogenase class-3 OS=Octopus vulgaris PE=1 SV=1 20 234 6.0E-08
sp|P9WQC3|ADH_MYCTU Probable alcohol dehydrogenase adh OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adh PE=1 SV=1 8 240 6.0E-08
sp|P9WQC2|ADH_MYCTO Probable alcohol dehydrogenase adh OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adh PE=3 SV=1 8 240 6.0E-08
sp|Q9P6I8|YHG1_SCHPO Zinc-type alcohol dehydrogenase-like protein C1198.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.01 PE=3 SV=1 6 233 8.0E-08
sp|P17648|ADH_FRAAN Alcohol dehydrogenase OS=Fragaria ananassa GN=ADH PE=3 SV=2 8 242 9.0E-08
sp|A1CFY8|XYL2_ASPCL Probable D-xylulose reductase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xdhA PE=3 SV=2 33 243 1.0E-07
sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 62 233 1.0E-07
sp|P00327|ADH1E_HORSE Alcohol dehydrogenase E chain OS=Equus caballus PE=1 SV=2 8 220 2.0E-07
sp|A1D9C9|XYL2_NEOFI Probable D-xylulose reductase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xdhA PE=3 SV=1 33 233 2.0E-07
sp|Q4WAU7|XYL2_ASPFU Probable D-xylulose reductase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xdhA PE=3 SV=2 33 233 2.0E-07
sp|B0YC65|XYL2_ASPFC Probable D-xylulose reductase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xdhA PE=3 SV=2 33 233 2.0E-07
sp|P00328|ADH1S_HORSE Alcohol dehydrogenase S chain OS=Equus caballus PE=1 SV=3 8 220 4.0E-07
sp|Q07993|XYL2_YEAST D-xylulose reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XYL2 PE=1 SV=1 1 221 5.0E-07
sp|P25984|ADH_CLOBE NADP-dependent isopropanol dehydrogenase OS=Clostridium beijerinckii GN=adh PE=1 SV=2 21 237 5.0E-07
sp|Q0CWQ2|XYL2_ASPTN Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 34 215 1.0E-06
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 6 341 2.0E-06
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 33 338 2.0E-06
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 23 323 2.0E-06
sp|P09347|FDEH_PSEPU 5-exo-hydroxycamphor dehydrogenase OS=Pseudomonas putida GN=camD PE=1 SV=2 23 240 3.0E-06
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 33 338 4.0E-06
sp|P39714|BDH1_YEAST (R,R)-butanediol dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH1 PE=1 SV=2 33 218 5.0E-06
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 21 89 6.0E-06
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 8 286 7.0E-06
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 8 286 7.0E-06
sp|O06012|ADHB_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein AdhB OS=Bacillus subtilis (strain 168) GN=adhB PE=3 SV=2 30 240 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7763
MTLVDTYRACVLDKPGCAWTLAQVSLEHPKQGEVLVKVICCGFCHTDASAQAGRLGPKPNWPLIPGHELIGDIVE
LGPGVTKWSVGDRVGGTWHGGHDGTCKQCEQGFFQACDNQAVNGMSRPGGFAEYCNLRSEAAVRIPKDADPVQMA
PFLCAGVTVFNAMRHQNVLPGETVAIQGLGGLGHLGIQYARKMGFRVVAISTGDSKKELALQLGAHHFINSSTTD
VVDELKKLGGAKMIVATSPDATAVGKYAAALTWRGKLVVLAPGHDFLVNSTQLLHMSCSVGGWHAGHALDCEEAI
NFAHLEGIRCMVETFPFEKIQDAAERVHSFKPRFRIVLTMQ*
Coding >OphauG2|7763
ATGACTCTCGTCGACACGTATCGAGCCTGCGTTTTGGATAAACCAGGATGTGCGTGGACCCTCGCCCAAGTTTCT
CTTGAGCATCCCAAGCAAGGAGAAGTCCTGGTCAAGGTGATTTGCTGTGGATTCTGCCACACCGATGCCAGTGCC
CAGGCGGGGCGGCTGGGGCCCAAACCCAATTGGCCGCTCATCCCTGGCCACGAGTTGATCGGTGACATTGTCGAG
TTGGGCCCGGGCGTAACCAAGTGGTCGGTAGGGGACCGGGTCGGTGGCACCTGGCACGGAGGCCACGATGGGACC
TGCAAGCAGTGCGAGCAGGGCTTCTTCCAGGCCTGTGACAACCAGGCCGTCAACGGCATGTCGAGGCCCGGTGGA
TTCGCCGAGTACTGCAACCTCCGAAGCGAGGCCGCTGTGAGAATCCCCAAAGACGCCGATCCCGTGCAGATGGCC
CCATTTCTCTGTGCCGGCGTCACCGTCTTCAACGCGATGCGGCATCAGAATGTCCTTCCGGGAGAAACCGTGGCC
ATCCAGGGCCTCGGAGGACTGGGCCATCTGGGGATTCAATACGCTCGAAAAATGGGCTTCCGGGTTGTCGCCATC
TCCACAGGCGATTCCAAGAAGGAGCTCGCGCTACAGCTCGGGGCGCACCACTTTATCAACTCGAGCACCACAGAC
GTGGTGGACGAGCTCAAGAAGCTTGGCGGCGCAAAGATGATTGTGGCTACATCTCCAGACGCTACCGCCGTGGGC
AAGTACGCAGCTGCTCTAACCTGGAGGGGCAAGCTAGTTGTCCTGGCTCCCGGCCATGATTTCCTCGTCAACTCG
ACCCAGCTACTCCACATGTCGTGCTCGGTGGGAGGCTGGCATGCAGGCCATGCTCTTGATTGCGAGGAAGCCATC
AACTTTGCTCACCTTGAGGGGATTCGCTGCATGGTGGAAACGTTTCCGTTTGAAAAGATTCAAGACGCTGCGGAG
CGCGTGCATAGTTTCAAGCCCCGCTTCAGGATCGTCTTGACCATGCAGTGA
Transcript >OphauG2|7763
ATGACTCTCGTCGACACGTATCGAGCCTGCGTTTTGGATAAACCAGGATGTGCGTGGACCCTCGCCCAAGTTTCT
CTTGAGCATCCCAAGCAAGGAGAAGTCCTGGTCAAGGTGATTTGCTGTGGATTCTGCCACACCGATGCCAGTGCC
CAGGCGGGGCGGCTGGGGCCCAAACCCAATTGGCCGCTCATCCCTGGCCACGAGTTGATCGGTGACATTGTCGAG
TTGGGCCCGGGCGTAACCAAGTGGTCGGTAGGGGACCGGGTCGGTGGCACCTGGCACGGAGGCCACGATGGGACC
TGCAAGCAGTGCGAGCAGGGCTTCTTCCAGGCCTGTGACAACCAGGCCGTCAACGGCATGTCGAGGCCCGGTGGA
TTCGCCGAGTACTGCAACCTCCGAAGCGAGGCCGCTGTGAGAATCCCCAAAGACGCCGATCCCGTGCAGATGGCC
CCATTTCTCTGTGCCGGCGTCACCGTCTTCAACGCGATGCGGCATCAGAATGTCCTTCCGGGAGAAACCGTGGCC
ATCCAGGGCCTCGGAGGACTGGGCCATCTGGGGATTCAATACGCTCGAAAAATGGGCTTCCGGGTTGTCGCCATC
TCCACAGGCGATTCCAAGAAGGAGCTCGCGCTACAGCTCGGGGCGCACCACTTTATCAACTCGAGCACCACAGAC
GTGGTGGACGAGCTCAAGAAGCTTGGCGGCGCAAAGATGATTGTGGCTACATCTCCAGACGCTACCGCCGTGGGC
AAGTACGCAGCTGCTCTAACCTGGAGGGGCAAGCTAGTTGTCCTGGCTCCCGGCCATGATTTCCTCGTCAACTCG
ACCCAGCTACTCCACATGTCGTGCTCGGTGGGAGGCTGGCATGCAGGCCATGCTCTTGATTGCGAGGAAGCCATC
AACTTTGCTCACCTTGAGGGGATTCGCTGCATGGTGGAAACGTTTCCGTTTGAAAAGATTCAAGACGCTGCGGAG
CGCGTGCATAGTTTCAAGCCCCGCTTCAGGATCGTCTTGACCATGCAGTGA
Gene >OphauG2|7763
ATGACTCTCGTCGACACGTATCGAGCCTGCGTTTTGGATAAACCAGGATGTGCGTGGACCCTCGCCCAAGTTTCT
CTTGAGCATCCCAAGCAAGGAGAAGTCCTGGTCAAGGTGATTTGCTGTGGATTCTGCCACACCGATGCCAGTGCC
CAGGCGGGGCGGCTGGGGCCCAAGTTTGTCATTCCAATCTCGCGTGCCATTCGTTGAGTGTCAGCTTTATGTGAT
GCTGTCATTATGACTGCAATTGTTGTTTCCGAGGAAATACTCACAGGCTGACAGAATGCTGACAACTATAGACCC
AATTGGCCGCTCATCCCTGGCCACGAGTTGATCGGTGACATTGTCGAGTTGGGCCCGGGCGTAACCAAGTGGTCG
GTAGGGGACCGGGTCGGTGGCACCTGGCACGGAGGCCACGATGGGACCTGCAAGCAGTGCGAGCAGGGCTTCTTC
CAGGCCTGTGACAACCAGGCCGTCAACGGCATGTCGAGGCCCGGTGGATGTAAGTAGAGACGTTGATTTGCGTTT
TGCAGCCGCCTAACGCGTTCTGGACATAGTCGCCGAGTACTGCAACCTCCGAAGCGAGGCCGCTGTGAGAATCCC
CAAAGACGCCGATCCCGTGCAGATGGCCCCATTTCTCTGTGCCGGCGTCACCGTCTTCAACGCGATGCGGCATCA
GAATGTCCTTCCGGGAGAAACCGTGGCCATCCAGGGCCTCGGAGGACTGGGCCATCTGGGGATTCAATACGCTCG
AAAAATGGGCTTCCGGGTTGTCGCCATCTCCACAGGCGATTCCAAGAAGGAGCTCGCGCTACAGCTCGGGGCGCA
CCACTTTATCAACTCGAGCACCACAGACGTGGTGGACGAGCTCAAGAAGCTTGGCGGCGCAAAGATGATTGTGGC
TACATCTCCAGACGCTACCGCCGTGGGCAAGTACGCAGCTGCTCTAACCTGGAGGGGCAAGCTAGTTGTCCTGGC
TCGTAAGTGTTGGCGAGACGCTTGACATTTGGATGAAGTGGTGGCAAGCTGACGTATGCAACAGCCGGCCATGAT
TTCCTCGTCAACTCGACCCAGCTACTCCACATGTCGTGCTCGGTGGGAGGCTGGCATGCAGGCCATGCTCTTGAT
TGCGAGGAAGCCATCAACTTTGCTCACCTTGAGGGGATTCGCTGCATGGTGGAAACGTTTCCGTTTGAAAAGATT
CAAGACGCTGCGGAGCGCGTGCATAGTTTCAAGCCCCGCTTCAGGATCGTCTTGACCATGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail