Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7759
Gene name
LocationContig_939:4045..7247
Strand+
Gene length (bp)3202
Transcript length (bp)2916
Coding sequence length (bp)2916
Protein length (aa) 972

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10257 RAI16-like Retinoic acid induced 16-like protein 4.5E-72 81 449
PF19314 DUF5917 Family of unknown function (DUF5917) 3.1E-06 574 709

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VQK0|U518_DROME UPF0518 protein CG3558 OS=Drosophila melanogaster GN=CG3558 PE=1 SV=1 58 394 6.0E-08
sp|A7S6A1|U518_NEMVE UPF0518 protein v1g243165 OS=Nematostella vectensis GN=v1g243165 PE=3 SV=1 62 275 6.0E-08
sp|B4LQW4|U518_DROVI UPF0518 protein GJ17503 OS=Drosophila virilis GN=GJ17503 PE=3 SV=1 80 394 1.0E-07
sp|Q7PZ36|U518_ANOGA UPF0518 protein AGAP011705 OS=Anopheles gambiae GN=AGAP011705 PE=3 SV=4 78 394 2.0E-07
sp|Q05DH4|F16A1_HUMAN Protein FAM160A1 OS=Homo sapiens GN=FAM160A1 PE=2 SV=2 9 273 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VQK0|U518_DROME UPF0518 protein CG3558 OS=Drosophila melanogaster GN=CG3558 PE=1 SV=1 58 394 6.0E-08
sp|A7S6A1|U518_NEMVE UPF0518 protein v1g243165 OS=Nematostella vectensis GN=v1g243165 PE=3 SV=1 62 275 6.0E-08
sp|B4LQW4|U518_DROVI UPF0518 protein GJ17503 OS=Drosophila virilis GN=GJ17503 PE=3 SV=1 80 394 1.0E-07
sp|Q7PZ36|U518_ANOGA UPF0518 protein AGAP011705 OS=Anopheles gambiae GN=AGAP011705 PE=3 SV=4 78 394 2.0E-07
sp|Q05DH4|F16A1_HUMAN Protein FAM160A1 OS=Homo sapiens GN=FAM160A1 PE=2 SV=2 9 273 2.0E-07
sp|B4NXB9|U518_DROYA UPF0518 protein GE18198 OS=Drosophila yakuba GN=GE18198 PE=3 SV=1 58 394 2.0E-07
sp|B4KJS5|U518_DROMO UPF0518 protein GI14169 OS=Drosophila mojavensis GN=GI14169 PE=3 SV=1 207 394 3.0E-07
sp|B3NAN9|U518_DROER UPF0518 protein GG24907 OS=Drosophila erecta GN=GG24907 PE=3 SV=1 58 394 3.0E-07
sp|B4G8N3|U518_DROPE UPF0518 protein GL19323 OS=Drosophila persimilis GN=GL19323 PE=3 SV=1 80 394 4.0E-07
sp|B3MLI0|U518_DROAN UPF0518 protein GF15501 OS=Drosophila ananassae GN=GF15501 PE=3 SV=1 68 394 4.0E-07
sp|B5DI68|U518_DROPS UPF0518 protein GA25918 OS=Drosophila pseudoobscura pseudoobscura GN=GA25918 PE=3 SV=1 80 394 6.0E-07
sp|B4JQY3|U518_DROGR UPF0518 protein GH13096 OS=Drosophila grimshawi GN=GH13096 PE=3 SV=1 80 394 7.0E-07
sp|Q505K2|F16A1_MOUSE Protein FAM160A1 OS=Mus musculus GN=Fam160a1 PE=1 SV=2 109 273 1.0E-06
sp|B0X755|U518_CULQU UPF0518 protein CPIJ015043 OS=Culex quinquefasciatus GN=CPIJ015043 PE=3 SV=1 199 394 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7759 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6215
Ophiocordyceps camponoti-floridani Ophcf2|03423
Ophiocordyceps camponoti-rufipedis Ophun1|2416
Ophiocordyceps kimflemingae Ophio5|8461
Ophiocordyceps subramaniannii Hirsu2|2589

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7759
MDFWSRLLSPLSSATSRQDEAKDPAKRLLRFEKEYAGLLTRWRNSSNLTRDSDAAEAIEIRLQELTNLLSNESRR
PLPHPCIQYASSKQIYVPIGKIATTSLNEWIVKEAVELFATLVESEEEAFVENAAFSSSLTNLLVRITGVNSLGL
GLECETRVVELAFNITTKIRLDPDILPAWFKAHNGGGPESSHAQVRQTFAGRTQRGDFPLFYVLMDYIHHEGKVG
DFARTGLLYIIEAASSSAALEQWIVESDLSTLMATGLGALYSQLSRKLVIDHLPHSLPPILALSDYQHPPCSYEV
VSSCAPQFQSHLETFLSHLLFWQDVLNHCRSVEVKSTLLEHFQVIFLQQLLYPSLLESSDIDGGSSVAVLTYLRR
ILECLQHPDMINLILHYLLALPDVRRSKEAKSKSSVSDARKRKSMDLATMMAQRTEETATPLLFNLVDLILACLT
SRNQQTVNVTLQLVSAILKRHHGYAVLTLLKTELLPPDAGSRRTVGAHDQEVEYLMSLAGLIGGNANFDEIYQGL
LKDAMTRLESHPCSLPLISPRLSTDGHKLPDNPPGAPRHVRQHTLGSQDALLNAVLDLLETFFINPVEMNLSITE
AIVDLATCGYTGLEGWLARSPKTYTYSDTEDEDDTLGETDGHVDGPPLSASEAKRLKAIEECRRRPEWRLESGPR
ILGVLQRLCDQIDAYRATVPRFGDLVQQRREAFQAADAMLDNGPAARQSSPALQETPERPSLEEAAASASPARPS
TLEGLAQRLLSELGTPSRTGSPRGRKERNKTASGASSPSASLGSTPRGGAAAAAAAASSSSSRVAPREFPINYSE
PSKSRVGIMGSVSPGSDAETGNSGGGAGGGEDSSGVSSQAAAFAAIDQSILARRVGLVVADYDLKPIPLDLEPKT
RIGDVGGKEGEEEEEEEGEAVVGGEARGGNEETTVSVSHVVTNVIVLQAFLLELAALMQVRASLFGEVRYV*
Coding >OphauG2|7759
ATGGATTTTTGGTCGCGCCTGTTGAGCCCCCTATCGTCGGCCACGTCTCGCCAGGACGAGGCCAAGGATCCTGCC
AAGCGGCTACTGCGGTTTGAAAAGGAGTATGCTGGGCTGTTGACACGATGGCGCAACTCGTCCAACTTGACGCGC
GACAGCGACGCGGCCGAGGCGATTGAGATCCGGCTGCAGGAACTGACCAACCTGCTGAGCAACGAAAGCCGGCGG
CCGCTGCCGCATCCGTGCATCCAGTATGCGTCGAGCAAGCAAATCTACGTGCCCATTGGCAAGATTGCCACGACG
TCGCTCAACGAATGGATAGTCAAGGAGGCGGTGGAGCTGTTTGCCACGCTGGTGGAGAGCGAGGAGGAGGCGTTT
GTGGAGAATGCCGCCTTTTCATCCAGCCTGACCAATCTGCTGGTGCGCATCACGGGCGTCAACAGTCTTGGGCTG
GGCCTCGAGTGCGAGACGCGCGTGGTGGAGCTGGCCTTTAACATCACCACCAAGATTCGTCTGGACCCGGACATT
CTGCCGGCCTGGTTCAAGGCACACAATGGAGGCGGGCCAGAGAGCAGCCACGCCCAGGTGCGGCAGACGTTTGCT
GGGCGCACGCAGCGCGGCGATTTCCCCCTCTTTTACGTGCTCATGGACTACATCCACCACGAGGGCAAGGTGGGC
GATTTTGCGCGCACCGGGCTGCTGTACATTATCGAGGCGGCGTCGAGCTCGGCCGCGCTGGAGCAGTGGATTGTG
GAGAGCGACTTGTCCACCCTCATGGCCACGGGGCTGGGCGCGCTGTATAGCCAGCTCAGCCGCAAGCTCGTCATT
GACCATTTGCCGCATAGCCTGCCGCCCATTCTGGCTCTGTCCGACTACCAGCACCCGCCTTGCAGCTACGAGGTT
GTGAGCTCGTGTGCGCCGCAGTTCCAGTCGCATCTGGAAACCTTTCTCTCCCATCTCTTGTTCTGGCAGGACGTC
TTGAACCACTGTAGATCAGTAGAGGTCAAGTCGACGCTGCTTGAGCACTTTCAAGTCATTTTCCTACAACAGTTG
CTCTACCCTTCGCTCCTGGAATCATCCGACATTGACGGTGGCTCATCTGTGGCTGTCTTGACGTATCTGCGTCGC
ATCCTCGAGTGTCTCCAGCACCCAGACATGATTAACCTGATTCTTCACTATTTACTCGCTCTCCCCGACGTCCGA
CGCTCCAAAGAGGCCAAGTCCAAGTCGTCGGTCAGCGACGCGCGCAAACGAAAGTCGATGGATCTTGCAACAATG
ATGGCCCAACGCACCGAGGAAACGGCAACGCCCTTGCTCTTCAATCTCGTTGACCTCATCCTCGCCTGTCTAACA
TCTCGCAACCAGCAGACAGTCAATGTGACTCTTCAGCTCGTGTCTGCCATACTCAAGAGGCATCATGGATATGCA
GTCTTGACATTGCTCAAGACGGAGCTCTTGCCGCCCGATGCAGGAAGCCGCCGAACTGTTGGTGCCCACGATCAA
GAGGTGGAATATCTCATGTCGCTTGCCGGCTTGATTGGAGGCAATGCCAACTTTGATGAGATTTACCAGGGCCTG
CTCAAGGACGCCATGACACGGCTTGAGAGCCACCCCTGCTCGCTGCCGCTGATTTCGCCGCGACTATCGACAGAT
GGCCACAAGCTGCCAGACAATCCGCCAGGGGCTCCGAGACACGTGCGACAACACACGCTTGGAAGCCAAGACGCG
CTGCTCAATGCCGTGCTCGACCTGCTTGAAACCTTCTTCATCAACCCTGTCGAGATGAACCTGTCTATTACCGAG
GCCATTGTTGATCTGGCGACATGTGGCTACACGGGGCTGGAAGGATGGCTGGCCAGAAGCCCCAAGACATACACG
TATAGCGACACGGAAGACGAAGACGACACTCTTGGTGAGACAGACGGACATGTTGACGGGCCGCCCCTGTCGGCT
TCCGAGGCCAAGAGACTCAAGGCCATTGAAGAGTGTCGTCGGAGGCCGGAATGGCGTCTTGAATCTGGCCCGCGG
ATTCTCGGCGTGCTACAACGTCTCTGCGACCAAATAGACGCATACCGAGCCACGGTGCCACGGTTTGGAGACCTT
GTGCAGCAGCGGCGGGAAGCGTTCCAGGCCGCTGACGCCATGCTGGACAATGGCCCGGCTGCACGACAATCATCT
CCCGCGCTCCAAGAAACGCCGGAGCGGCCGAGCCTTGAGGAAGCGGCAGCGTCAGCATCACCGGCGCGGCCGTCG
ACGCTAGAGGGGCTGGCCCAACGTCTCTTGTCGGAGCTGGGGACGCCGAGCCGGACGGGAAGCCCGCGTGGGCGC
AAGGAGCGCAACAAGACAGCCTCGGGGGCATCAAGCCCAAGCGCATCGTTGGGCAGCACGCCGCGGGGGGGAGCA
GCAGCAGCAGCAGCAGCAGCATCATCATCATCATCACGGGTGGCGCCTCGCGAGTTCCCCATCAACTACTCAGAG
CCGAGCAAGAGCCGCGTTGGCATCATGGGCAGTGTGTCTCCGGGCAGCGACGCGGAGACGGGGAACTCGGGAGGA
GGAGCAGGCGGCGGCGAAGACAGCAGCGGGGTGTCGAGTCAAGCCGCAGCGTTTGCGGCCATTGACCAAAGCATC
CTAGCCAGGCGTGTTGGGCTGGTGGTGGCAGACTATGACTTGAAGCCGATTCCGCTGGACCTGGAGCCCAAGACT
CGGATTGGAGATGTGGGGGGTAAAGAAGGAGAAGAAGAAGAGGAAGAGGAAGGGGAAGCAGTGGTGGGTGGCGAG
GCGAGGGGGGGGAACGAGGAGACGACGGTGTCGGTGTCGCATGTGGTGACCAATGTCATTGTTTTGCAGGCCTTT
TTGCTTGAGCTAGCCGCTCTGATGCAGGTGCGGGCAAGTCTATTTGGGGAAGTGCGATATGTATAG
Transcript >OphauG2|7759
ATGGATTTTTGGTCGCGCCTGTTGAGCCCCCTATCGTCGGCCACGTCTCGCCAGGACGAGGCCAAGGATCCTGCC
AAGCGGCTACTGCGGTTTGAAAAGGAGTATGCTGGGCTGTTGACACGATGGCGCAACTCGTCCAACTTGACGCGC
GACAGCGACGCGGCCGAGGCGATTGAGATCCGGCTGCAGGAACTGACCAACCTGCTGAGCAACGAAAGCCGGCGG
CCGCTGCCGCATCCGTGCATCCAGTATGCGTCGAGCAAGCAAATCTACGTGCCCATTGGCAAGATTGCCACGACG
TCGCTCAACGAATGGATAGTCAAGGAGGCGGTGGAGCTGTTTGCCACGCTGGTGGAGAGCGAGGAGGAGGCGTTT
GTGGAGAATGCCGCCTTTTCATCCAGCCTGACCAATCTGCTGGTGCGCATCACGGGCGTCAACAGTCTTGGGCTG
GGCCTCGAGTGCGAGACGCGCGTGGTGGAGCTGGCCTTTAACATCACCACCAAGATTCGTCTGGACCCGGACATT
CTGCCGGCCTGGTTCAAGGCACACAATGGAGGCGGGCCAGAGAGCAGCCACGCCCAGGTGCGGCAGACGTTTGCT
GGGCGCACGCAGCGCGGCGATTTCCCCCTCTTTTACGTGCTCATGGACTACATCCACCACGAGGGCAAGGTGGGC
GATTTTGCGCGCACCGGGCTGCTGTACATTATCGAGGCGGCGTCGAGCTCGGCCGCGCTGGAGCAGTGGATTGTG
GAGAGCGACTTGTCCACCCTCATGGCCACGGGGCTGGGCGCGCTGTATAGCCAGCTCAGCCGCAAGCTCGTCATT
GACCATTTGCCGCATAGCCTGCCGCCCATTCTGGCTCTGTCCGACTACCAGCACCCGCCTTGCAGCTACGAGGTT
GTGAGCTCGTGTGCGCCGCAGTTCCAGTCGCATCTGGAAACCTTTCTCTCCCATCTCTTGTTCTGGCAGGACGTC
TTGAACCACTGTAGATCAGTAGAGGTCAAGTCGACGCTGCTTGAGCACTTTCAAGTCATTTTCCTACAACAGTTG
CTCTACCCTTCGCTCCTGGAATCATCCGACATTGACGGTGGCTCATCTGTGGCTGTCTTGACGTATCTGCGTCGC
ATCCTCGAGTGTCTCCAGCACCCAGACATGATTAACCTGATTCTTCACTATTTACTCGCTCTCCCCGACGTCCGA
CGCTCCAAAGAGGCCAAGTCCAAGTCGTCGGTCAGCGACGCGCGCAAACGAAAGTCGATGGATCTTGCAACAATG
ATGGCCCAACGCACCGAGGAAACGGCAACGCCCTTGCTCTTCAATCTCGTTGACCTCATCCTCGCCTGTCTAACA
TCTCGCAACCAGCAGACAGTCAATGTGACTCTTCAGCTCGTGTCTGCCATACTCAAGAGGCATCATGGATATGCA
GTCTTGACATTGCTCAAGACGGAGCTCTTGCCGCCCGATGCAGGAAGCCGCCGAACTGTTGGTGCCCACGATCAA
GAGGTGGAATATCTCATGTCGCTTGCCGGCTTGATTGGAGGCAATGCCAACTTTGATGAGATTTACCAGGGCCTG
CTCAAGGACGCCATGACACGGCTTGAGAGCCACCCCTGCTCGCTGCCGCTGATTTCGCCGCGACTATCGACAGAT
GGCCACAAGCTGCCAGACAATCCGCCAGGGGCTCCGAGACACGTGCGACAACACACGCTTGGAAGCCAAGACGCG
CTGCTCAATGCCGTGCTCGACCTGCTTGAAACCTTCTTCATCAACCCTGTCGAGATGAACCTGTCTATTACCGAG
GCCATTGTTGATCTGGCGACATGTGGCTACACGGGGCTGGAAGGATGGCTGGCCAGAAGCCCCAAGACATACACG
TATAGCGACACGGAAGACGAAGACGACACTCTTGGTGAGACAGACGGACATGTTGACGGGCCGCCCCTGTCGGCT
TCCGAGGCCAAGAGACTCAAGGCCATTGAAGAGTGTCGTCGGAGGCCGGAATGGCGTCTTGAATCTGGCCCGCGG
ATTCTCGGCGTGCTACAACGTCTCTGCGACCAAATAGACGCATACCGAGCCACGGTGCCACGGTTTGGAGACCTT
GTGCAGCAGCGGCGGGAAGCGTTCCAGGCCGCTGACGCCATGCTGGACAATGGCCCGGCTGCACGACAATCATCT
CCCGCGCTCCAAGAAACGCCGGAGCGGCCGAGCCTTGAGGAAGCGGCAGCGTCAGCATCACCGGCGCGGCCGTCG
ACGCTAGAGGGGCTGGCCCAACGTCTCTTGTCGGAGCTGGGGACGCCGAGCCGGACGGGAAGCCCGCGTGGGCGC
AAGGAGCGCAACAAGACAGCCTCGGGGGCATCAAGCCCAAGCGCATCGTTGGGCAGCACGCCGCGGGGGGGAGCA
GCAGCAGCAGCAGCAGCAGCATCATCATCATCATCACGGGTGGCGCCTCGCGAGTTCCCCATCAACTACTCAGAG
CCGAGCAAGAGCCGCGTTGGCATCATGGGCAGTGTGTCTCCGGGCAGCGACGCGGAGACGGGGAACTCGGGAGGA
GGAGCAGGCGGCGGCGAAGACAGCAGCGGGGTGTCGAGTCAAGCCGCAGCGTTTGCGGCCATTGACCAAAGCATC
CTAGCCAGGCGTGTTGGGCTGGTGGTGGCAGACTATGACTTGAAGCCGATTCCGCTGGACCTGGAGCCCAAGACT
CGGATTGGAGATGTGGGGGGTAAAGAAGGAGAAGAAGAAGAGGAAGAGGAAGGGGAAGCAGTGGTGGGTGGCGAG
GCGAGGGGGGGGAACGAGGAGACGACGGTGTCGGTGTCGCATGTGGTGACCAATGTCATTGTTTTGCAGGCCTTT
TTGCTTGAGCTAGCCGCTCTGATGCAGGTGCGGGCAAGTCTATTTGGGGAAGTGCGATATGTATAG
Gene >OphauG2|7759
ATGGATTTTGTGAGCAGAGCAGTCAGTCGTGGGGCGATTGGCTTTTGGCGGCTAACAAGGGGGCTTGTCTATAGT
GGTCGCGCCTGTTGAGCCCCCTATCGTCGGCCACGTCTCGCCAGGACGAGGCCAAGGATCCTGCCAAGCGGCTAC
TGCGGTTTGAAAAGGAGTATGCTGGGCTGTTGGTAAGTGGTCTCTTTATATACAGGAGGCACCTGGACGGGTGAA
TCAAGGGCATGATGCTAATGGGCTGGAGCGCATAGACACGATGGCGCAACTCGTCCAACTTGACGCGCGACAGCG
ACGCGGCCGAGGCGATTGAGATCCGGCTGCAGGAACTGACCAACCTGCTGAGCAACGAAAGCCGGCGGCCGCTGC
CGCATCCGTGCATCCAGTATGCGTCGAGCAAGCAAATCTACGTGCCCATTGGCAAGATTGCCACGACGTCGCTCA
ACGAATGGATAGTCAAGGAGGCGGTGGAGCTGTTTGCCACGCTGGTGGAGAGCGAGGAGGAGGCGTTTGTGGAGA
ATGCCGCCTTTTCATCCAGCCTGACCAATCTGCTGGTGCGCATCACGGGCGTCAACAGTCTTGGGCTGGGCCTCG
AGTGCGAGACGCGCGTGGTGGAGCTGGCCTTTAACATCACCACCAAGATTCGTCTGGACCCGGACATTCTGCCGG
CCTGGTTCAAGGCACACAATGGAGGCGGGCCAGAGAGCAGCCACGCCCAGGTGCGGCAGACGTTTGCTGGGCGCA
CGCAGCGCGGCGATTTCCCCCTCTTTTACGTGCTCATGGACTACATCCACCACGAGGGCAAGGTGGGCGATTTTG
CGCGCACCGGGCTGCTGTACATTATCGAGGCGGCGTCGAGCTCGGCCGCGCTGGAGCAGTGGATTGTGGAGAGCG
ACTTGTCCACCCTCATGGCCACGGGGCTGGGCGCGCTGTATAGCCAGCTCAGCCGCAAGCTCGTCATTGACCATT
TGCCGCATAGCCTGCCGCCCATTCTGGCTCTGTCCGACTACCAGCACCCGCCTTGCAGCTACGAGGTTGTGAGCT
CGTGTGCGCCGCAGTTCCAGTCGCATCTGGAAACCTTTCTCTCCCATCTCTTGTTCTGGCAGGACGTCTTGAACC
ACTGTAGATCAGTAGAGGTCAAGTCGACGCTGCTTGAGCACTTTCAAGTCATTTTCCTACAACAGTTGCTGTGCG
TAGTAGTCTTTGCATCCCCATTCCATTCATACTTGGCCATTCACCCTTGGCCATTCACACACTTGGCAATTCACA
CACTCGGCCATTCACCCTTGGCTCCGAGCGCCTCTGTGCTAACTACTGCTTCCCCAACCCTAGCTACCCTTCGCT
CCTGGAATCATCCGACATTGACGGTGGCTCATCTGTGGCTGTCTTGACGTATCTGCGTCGCATCCTCGAGTGTCT
CCAGCACCCAGACATGATTAACCTGATTCTTCACTATTTACTCGCTCTCCCCGACGTCCGACGCTCCAAAGAGGC
CAAGTCCAAGTCGTCGGTCAGCGACGCGCGCAAACGAAAGTCGATGGATCTTGCAACAATGATGGCCCAACGCAC
CGAGGAAACGGCAACGCCCTTGCTCTTCAATCTCGTTGACCTCATCCTCGCCTGTCTAACATCTCGCAACCAGCA
GACAGTCAATGTGACTCTTCAGCTCGTGTCTGCCATACTCAAGAGGCATCATGGATATGCAGTCTTGACATTGCT
CAAGACGGAGCTCTTGCCGCCCGATGCAGGAAGCCGCCGAACTGTTGGTGCCCACGATCAAGAGGTGGAATATCT
CATGTCGCTTGCCGGCTTGATTGGAGGCAATGCCAACTTTGATGAGATTTACCAGGGCCTGCTCAAGGACGCCAT
GACACGGCTTGAGAGCCACCCCTGCTCGCTGCCGCTGATTTCGCCGCGACTATCGACAGATGGCCACAAGCTGCC
AGACAATCCGCCAGGGGCTCCGAGACACGTGCGACAACACACGCTTGGAAGCCAAGACGCGCTGCTCAATGCCGT
GCTCGACCTGCTTGAAACCTTCTTCATCAACCCTGTCGAGATGAACCTGTCTATTACCGAGGCCATTGTTGATCT
GGCGACATGTGGCTACACGGGGCTGGAAGGATGGCTGGCCAGAAGCCCCAAGACATACACGTATAGCGACACGGA
AGACGAAGACGACACTCTTGGTGAGACAGACGGACATGTTGACGGGCCGCCCCTGTCGGCTTCCGAGGCCAAGAG
ACTCAAGGCCATTGAAGAGTGTCGTCGGAGGCCGGAATGGCGTCTTGAATCTGGCCCGCGGATTCTCGGCGTGCT
ACAACGTCTCTGCGACCAAATAGACGCATACCGAGCCACGGTGCCACGGTTTGGAGACCTTGTGCAGCAGCGGCG
GGAAGCGTTCCAGGCCGCTGACGCCATGCTGGACAATGGCCCGGCTGCACGACAATCATCTCCCGCGCTCCAAGA
AACGCCGGAGCGGCCGAGCCTTGAGGAAGCGGCAGCGTCAGCATCACCGGCGCGGCCGTCGACGCTAGAGGGGCT
GGCCCAACGTCTCTTGTCGGAGCTGGGGACGCCGAGCCGGACGGGAAGCCCGCGTGGGCGCAAGGAGCGCAACAA
GACAGCCTCGGGGGCATCAAGCCCAAGCGCATCGTTGGGCAGCACGCCGCGGGGGGGAGCAGCAGCAGCAGCAGC
AGCAGCATCATCATCATCATCACGGGTGGCGCCTCGCGAGTTCCCCATCAACTACTCAGAGCCGAGCAAGAGCCG
CGTTGGCATCATGGGCAGTGTGTCTCCGGGCAGCGACGCGGAGACGGGGAACTCGGGAGGAGGAGCAGGCGGCGG
CGAAGACAGCAGCGGGGTGTCGAGTCAAGCCGCAGCGTTTGCGGCCATTGACCAAAGCATCCTAGCCAGGCGTGT
TGGGCTGGTGGTGGCAGACTATGACTTGAAGCCGATTCCGCTGGACCTGGAGCCCAAGACTCGGATTGGAGATGT
GGGGGGTAAAGAAGGAGAAGAAGAAGAGGAAGAGGAAGGGGAAGCAGTGGTGGGTGGCGAGGCGAGGGGGGGGAA
CGAGGAGACGACGGTGTCGGTGTCGCATGTGGTGACCAATGTCATTGTTTTGCAGGCCTTTTTGCTTGAGCTAGC
CGCTCTGATGCAGGTGCGGGCAAGTCTATTTGGGGAAGTGCGATATGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail