Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7755
Gene name
LocationContig_937:4665..5802
Strand-
Gene length (bp)1137
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.8E-28 81 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 67 327 2.0E-36
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 67 340 2.0E-35
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 68 327 2.0E-35
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 68 327 2.0E-35
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 68 327 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 67 327 2.0E-36
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 67 340 2.0E-35
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 68 327 2.0E-35
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 68 327 2.0E-35
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 68 327 2.0E-34
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 68 327 4.0E-34
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 65 337 1.0E-32
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 68 327 1.0E-30
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 68 327 1.0E-29
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 68 334 2.0E-28
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 68 327 5.0E-28
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 68 327 5.0E-28
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 68 327 1.0E-27
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 64 327 2.0E-27
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 67 327 3.0E-27
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 67 334 6.0E-27
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 67 334 1.0E-25
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 67 334 2.0E-25
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 67 327 3.0E-25
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 68 327 3.0E-24
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 69 334 1.0E-23
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 65 335 1.0E-17
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 70 263 6.0E-16
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 91 312 1.0E-15
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 83 313 6.0E-13
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 83 313 6.0E-13
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 90 313 5.0E-11
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 90 315 1.0E-10
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 90 315 2.0E-10
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 92 228 3.0E-10
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 97 312 6.0E-10
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 97 313 6.0E-10
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 97 312 3.0E-09
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 97 312 4.0E-09
sp|P22196|PER2_ARAHY Cationic peroxidase 2 OS=Arachis hypogaea GN=PNC2 PE=2 SV=1 92 314 8.0E-08
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 97 313 1.0E-07
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 97 313 1.0E-07
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 92 231 1.0E-07
sp|A5H453|PER42_MAIZE Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1 97 228 2.0E-07
sp|O23237|PER49_ARATH Peroxidase 49 OS=Arabidopsis thaliana GN=PER49 PE=2 SV=2 71 228 2.0E-07
sp|Q96512|PER9_ARATH Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1 92 228 3.0E-07
sp|Q9FX85|PER10_ARATH Peroxidase 10 OS=Arabidopsis thaliana GN=PER10 PE=1 SV=1 41 313 3.0E-07
sp|Q0D3N0|PER2_ORYSJ Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1 97 325 7.0E-07
sp|A7NY33|PER4_VITVI Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1 36 228 9.0E-07
sp|A2YPX3|PER2_ORYSI Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2 97 325 9.0E-07
sp|P11965|PERX_TOBAC Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1 97 267 9.0E-07
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 97 313 9.0E-07
sp|Q9FLC0|PER52_ARATH Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1 97 228 1.0E-06
sp|A5H454|PER66_MAIZE Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1 78 308 1.0E-06
sp|O80822|PER25_ARATH Peroxidase 25 OS=Arabidopsis thaliana GN=PER25 PE=2 SV=2 97 235 2.0E-06
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 97 282 2.0E-06
sp|Q96519|PER11_ARATH Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=1 SV=1 97 231 2.0E-06
sp|Q96511|PER69_ARATH Peroxidase 69 OS=Arabidopsis thaliana GN=PER69 PE=1 SV=1 97 228 3.0E-06
sp|A5H452|PER70_MAIZE Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1 78 275 4.0E-06
sp|P00434|PERP7_BRARR Peroxidase P7 OS=Brassica rapa subsp. rapa PE=1 SV=3 97 228 5.0E-06
sp|Q9FLV5|PER61_ARATH Probable peroxidase 61 OS=Arabidopsis thaliana GN=PER61 PE=3 SV=1 114 231 8.0E-06
sp|Q9SI17|PER14_ARATH Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=3 SV=1 78 247 8.0E-06
sp|Q96520|PER12_ARATH Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=1 SV=1 73 320 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0006950 response to stress No
GO:0008150 biological_process No
GO:0050896 response to stimulus No
GO:0046906 tetrapyrrole binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA2 3.9E-58 73 313

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup72
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7755 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5788
Ophiocordyceps camponoti-floridani Ophcf2|03380
Ophiocordyceps camponoti-floridani Ophcf2|05952
Ophiocordyceps camponoti-floridani Ophcf2|06949
Ophiocordyceps camponoti-rufipedis Ophun1|2842
Ophiocordyceps camponoti-rufipedis Ophun1|490
Ophiocordyceps camponoti-rufipedis Ophun1|576
Ophiocordyceps kimflemingae Ophio5|1136
Ophiocordyceps kimflemingae Ophio5|3516
Ophiocordyceps kimflemingae Ophio5|4077
Ophiocordyceps kimflemingae Ophio5|6981
Ophiocordyceps subramaniannii Hirsu2|2648
Ophiocordyceps subramaniannii Hirsu2|7177
Ophiocordyceps subramaniannii Hirsu2|7933
Ophiocordyceps subramaniannii Hirsu2|9306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7755
MESLLSRAPLQARSTQLIGDLATLSDSQLSATGQSIRAILNGSASGLDSTSSYAPPPQDSPACAADTCCIYAHIA
NAMRSAMLDASGQCNNLARASLRLGFHDASGWSSKTGPTGGADGSVVLAGECESRPENRGLQDTCRQMREWHNAY
RPYGVSMADLIQLAANVGTVVCPLGPRVRTFVGRQDCSQPAPEGNIPDPRHSVDKILAMFQDKTISPAGLVALVG
AHTASKQDFFDPASAGASQDTTPHIWDTAFYGNTLQEPAPQGIVRFDSDVGLSRDPRTSASWRGFQGAQGFWAFA
YGQEYVRLSLLGVPNINSLTECTKVLPPFIGTIPPGVDTN*
Coding >OphauG2|7755
ATGGAATCTCTGCTCTCCAGGGCTCCCCTCCAGGCCCGTTCCACCCAGCTCATCGGCGACCTCGCCACCCTCTCC
GACTCTCAACTCTCGGCCACCGGCCAAAGCATCCGAGCCATCCTCAACGGCAGCGCATCTGGGCTCGACAGCACT
TCCTCCTACGCTCCCCCTCCTCAGGACTCTCCGGCCTGCGCCGCCGACACGTGCTGCATCTACGCCCATATCGCC
AATGCCATGCGAAGCGCCATGCTGGATGCGTCAGGCCAGTGCAACAACCTGGCGCGCGCCAGTCTCCGGCTCGGC
TTCCACGACGCGTCTGGCTGGTCGAGCAAAACAGGGCCGACTGGCGGCGCCGACGGGTCTGTCGTCTTGGCCGGC
GAGTGCGAGTCGCGGCCGGAAAACAGGGGCTTGCAAGACACGTGCCGGCAGATGCGAGAGTGGCACAACGCCTAC
AGGCCCTACGGGGTGTCCATGGCCGATCTGATCCAGCTGGCGGCCAATGTCGGCACCGTGGTCTGTCCGCTGGGC
CCGCGCGTGCGCACCTTTGTCGGCCGCCAGGACTGTAGCCAGCCGGCGCCCGAGGGCAACATCCCCGACCCGAGA
CACAGCGTCGACAAGATTCTGGCCATGTTCCAGGACAAGACCATTTCTCCAGCGGGTCTGGTTGCCCTTGTCGGC
GCTCACACAGCCAGCAAGCAAGACTTTTTCGATCCCGCCAGCGCCGGCGCCTCCCAAGACACCACGCCGCATATC
TGGGACACGGCCTTTTACGGAAACACTCTGCAGGAGCCTGCGCCCCAGGGCATTGTTCGCTTTGATAGTGATGTC
GGTCTGAGCCGGGATCCGCGAACCAGTGCCAGCTGGCGAGGCTTCCAGGGCGCCCAGGGCTTCTGGGCCTTTGCA
TACGGCCAGGAATATGTCCGCCTAAGCCTCCTCGGCGTCCCCAACATCAACTCCCTGACTGAATGCACAAAGGTC
CTCCCACCATTCATCGGCACCATCCCCCCCGGCGTCGATACAAACTAG
Transcript >OphauG2|7755
ATGGAATCTCTGCTCTCCAGGGCTCCCCTCCAGGCCCGTTCCACCCAGCTCATCGGCGACCTCGCCACCCTCTCC
GACTCTCAACTCTCGGCCACCGGCCAAAGCATCCGAGCCATCCTCAACGGCAGCGCATCTGGGCTCGACAGCACT
TCCTCCTACGCTCCCCCTCCTCAGGACTCTCCGGCCTGCGCCGCCGACACGTGCTGCATCTACGCCCATATCGCC
AATGCCATGCGAAGCGCCATGCTGGATGCGTCAGGCCAGTGCAACAACCTGGCGCGCGCCAGTCTCCGGCTCGGC
TTCCACGACGCGTCTGGCTGGTCGAGCAAAACAGGGCCGACTGGCGGCGCCGACGGGTCTGTCGTCTTGGCCGGC
GAGTGCGAGTCGCGGCCGGAAAACAGGGGCTTGCAAGACACGTGCCGGCAGATGCGAGAGTGGCACAACGCCTAC
AGGCCCTACGGGGTGTCCATGGCCGATCTGATCCAGCTGGCGGCCAATGTCGGCACCGTGGTCTGTCCGCTGGGC
CCGCGCGTGCGCACCTTTGTCGGCCGCCAGGACTGTAGCCAGCCGGCGCCCGAGGGCAACATCCCCGACCCGAGA
CACAGCGTCGACAAGATTCTGGCCATGTTCCAGGACAAGACCATTTCTCCAGCGGGTCTGGTTGCCCTTGTCGGC
GCTCACACAGCCAGCAAGCAAGACTTTTTCGATCCCGCCAGCGCCGGCGCCTCCCAAGACACCACGCCGCATATC
TGGGACACGGCCTTTTACGGAAACACTCTGCAGGAGCCTGCGCCCCAGGGCATTGTTCGCTTTGATAGTGATGTC
GGTCTGAGCCGGGATCCGCGAACCAGTGCCAGCTGGCGAGGCTTCCAGGGCGCCCAGGGCTTCTGGGCCTTTGCA
TACGGCCAGGAATATGTCCGCCTAAGCCTCCTCGGCGTCCCCAACATCAACTCCCTGACTGAATGCACAAAGGTC
CTCCCACCATTCATCGGCACCATCCCCCCCGGCGTCGATACAAACTAG
Gene >OphauG2|7755
ATGGAATCTCTGCTCTCCAGGGCTCCCCTCCAGGCCCGTTCCACCCAGCTCATCGGCGACCTCGCCACCCTCTCC
GACTCTCAACTCTCGGCCACCGGCCAAAGCATCCGAGCCATCCTCAACGGCAGCGCATCTGGGCTCGACAGCACT
TCCTCCTACGCTCCCCCTCCTCAGGACTCTCCGGCCTGCGCCGCCGACACGTGCTGCATCTACGCCCATATCGCC
AATGCCATGCGAAGCGCCATGCTGGATGCGTCAGGCCAGTGCAACAACCTGGCGCGCGCCAGTCTCCGGCTCGGC
TTCCACGACGCGTCTGGCTGGTCGAGCAAAACAGGGCCGACTGGCGGCGCCGACGGGTCTGTCGTCTTGGCCGGC
GAGTGCGAGTCGCGGCCGGAAAACAGGGGCTTGCAAGACACGTGCCGGCAGATGCGAGAGTGGCACAACGCCTAC
AGGCCCTACGGGGTGTCCATGGCCGATCTGATCCAGCTGGCGGCCAATGTCGGCACCGTGGTCTGTCCGCTGGGC
CCGCGCGTGCGCACCTTTGTCGGCCGCCAGGACTGTAGCCAGCCGGCGCCCGAGGGCAACATCCCCGACCCGAGA
CACAGCGTCGACAAGATTCTGGCCATGTTCCAGGACAAGACCATTTCTCCAGCGGGTCTGGTTGCCCTTGTCGGC
GCTCACACAGCCAGCAAGCAAGACTTTTTCGATCCCGCCAGCGCCGGCGCCTCCCAAGACACCACGCCGCATATC
TGGGACACGGCCTTTTACGGAAACACTCTGCAGGAGCCTGCGCCCCAGGGCATTGTTCGCTTTGATAGTGATGTC
GGTCTGAGCCGGGATCCGCGAACCAGTGCCAGCTGGCGAGGCTTCCAGGGCGCCCAGGGCTTCTGGGCCTTTGTA
AGTTGCTCCTTGTGTCGTGTCTTTTTTTTCTTCTCCTTGTTTCTTTATACCTCTTATTCATCTCTTTTGCATGAT
TCTTCTTCATTCCTTTCTAAAGCTTACACATGCCAGGCATACGGCCAGGAATATGTCCGCCTAAGCCTCCTCGGC
GTCCCCAACATCAACTCCCTGACTGAATGCACAAAGGTCCTCCCACCATTCATCGGCACCATCCCCCCCGGCGTC
GATACAAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail