Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7754
Gene name
LocationContig_937:2498..4085
Strand+
Gene length (bp)1587
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13002 LDB19 Arrestin_N terminal like 2.4E-38 159 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10347|YDA5_SCHPO Uncharacterized protein C1F12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.05 PE=4 SV=1 100 487 1.0E-45
sp|O60150|YNSK_SCHPO Uncharacterized protein C18H10.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.20c PE=1 SV=1 103 488 3.0E-45
sp|Q75BI0|LDB19_ASHGO Protein LDB19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB19 PE=3 SV=1 101 333 2.0E-29
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 162 333 5.0E-20
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 430 487 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10347|YDA5_SCHPO Uncharacterized protein C1F12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.05 PE=4 SV=1 100 487 1.0E-45
sp|O60150|YNSK_SCHPO Uncharacterized protein C18H10.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.20c PE=1 SV=1 103 488 3.0E-45
sp|Q75BI0|LDB19_ASHGO Protein LDB19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB19 PE=3 SV=1 101 333 2.0E-29
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 162 333 5.0E-20
sp|Q12502|LDB19_YEAST Protein LDB19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB19 PE=1 SV=1 430 487 1.0E-08
sp|Q75BI0|LDB19_ASHGO Protein LDB19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB19 PE=3 SV=1 438 487 5.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7754 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5787
Ophiocordyceps camponoti-floridani Ophcf2|05955
Ophiocordyceps camponoti-rufipedis Ophun1|7350
Ophiocordyceps kimflemingae Ophio5|3512
Ophiocordyceps subramaniannii Hirsu2|9310

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7754
MPHRVANFLRTSSGTIPHIKKKKSTTAANDLSRNSSLAPTRNNSLTTSPDDSDSDDHHSPRIMPDHLAEAIRRHH
RLSFPFARSSASSATSNSHPAASGPVGLDCSVESPPIVFHGSPEDSTGALISGQMFLDVRAESVDVERFAACLEM
RLVHRRPFQNHCSDCQRQSTDLKTWRLLRHTTTLKRGRHLFPFSALLDGKLPASMDTPVISISYHFRAEAVLVHS
PGSGPGSASPSASVTRVCFERPLDVKRSLPEPLYPHHSVRVFPPTNIKASAHYSAVIHPTGSNQLTLKLDGLLSR
NEKARTVDLWRLKKLTWRLEETVKTRAPACDKHAPPGTTSPPPAASDEETAKKTVARTETRVLGEKQLHDGWKSD
FGGTDGVVEMEFDFGVNQHHHQSSKSGPVSRYACDTKTPQGTEVTHSLLIELIVSKEYAPEGKTFLATQTGTGRI
LRMHFAVVMTEFPGLGVSWDNEAPPVYQDVPPSPPGYSPCRDGESPVEYEELEALVARRPSFDQRQLSAGPSSDG
AED*
Coding >OphauG2|7754
ATGCCTCACCGCGTAGCAAACTTTTTACGCACCTCGTCGGGCACCATCCCGCACATCAAGAAGAAAAAGTCGACA
ACGGCTGCCAACGACTTGTCGCGCAACAGCTCTCTCGCCCCGACGCGCAACAACTCCCTCACCACCAGCCCCGAT
GACTCCGACTCGGACGACCACCACAGCCCCAGAATAATGCCCGACCACCTGGCTGAAGCCATTCGACGCCATCAT
CGCCTCTCCTTCCCCTTTGCCCGCTCCAGTGCAAGTAGCGCCACCTCGAATTCCCACCCCGCTGCCTCGGGCCCC
GTCGGCCTCGACTGCAGTGTCGAGAGCCCGCCCATTGTCTTCCACGGCTCGCCAGAGGACAGCACCGGCGCTCTC
ATCTCGGGCCAAATGTTTCTCGACGTCCGCGCCGAAAGCGTCGACGTCGAGCGCTTTGCTGCCTGTCTCGAGATG
CGCCTCGTCCACCGCCGTCCCTTCCAGAACCACTGCTCCGACTGCCAGCGTCAGTCCACCGACCTCAAGACGTGG
CGTCTGCTGCGCCACACCACCACTCTCAAGCGTGGCCGCCACCTGTTTCCCTTTTCTGCCCTGCTCGACGGCAAG
CTCCCCGCCTCCATGGACACCCCCGTCATCTCCATCTCGTACCACTTCCGTGCCGAGGCCGTTCTTGTCCACTCG
CCCGGCTCCGGCCCCGGCTCCGCGTCGCCCTCGGCCTCGGTCACTCGCGTTTGCTTTGAGCGCCCGCTCGACGTC
AAGCGCTCGCTGCCAGAGCCGCTCTACCCCCACCACTCAGTCCGTGTCTTTCCACCCACCAACATCAAGGCTAGT
GCCCACTACAGCGCCGTCATTCACCCTACCGGCTCCAACCAGCTCACCCTCAAGCTCGACGGCCTCTTGTCTCGC
AACGAAAAGGCCCGCACCGTGGACCTGTGGCGCCTCAAGAAGCTGACATGGCGTCTCGAGGAGACTGTCAAGACT
CGTGCTCCCGCCTGTGACAAGCACGCCCCACCTGGCACCACGTCTCCTCCCCCTGCCGCCTCGGACGAAGAAACG
GCCAAGAAGACGGTGGCGCGCACCGAGACGCGCGTCCTGGGCGAGAAGCAGCTGCACGACGGGTGGAAGTCGGAC
TTTGGCGGCACCGACGGCGTCGTCGAGATGGAATTCGACTTTGGAGTCAACCAGCACCACCACCAGTCGTCCAAG
TCGGGCCCGGTTTCACGCTACGCCTGCGACACCAAGACGCCCCAGGGCACCGAAGTCACCCACTCGTTGCTCATT
GAGCTCATTGTCTCCAAGGAATACGCACCCGAGGGCAAGACCTTTTTGGCCACCCAGACTGGCACAGGCCGCATC
TTGCGAATGCATTTTGCCGTGGTCATGACTGAGTTTCCGGGCCTGGGCGTCAGCTGGGACAATGAGGCGCCTCCC
GTCTACCAAGACGTGCCGCCCAGTCCCCCGGGCTACTCGCCGTGCCGTGATGGCGAGTCGCCTGTCGAGTATGAG
GAGCTTGAGGCACTGGTTGCGCGGCGGCCGAGCTTTGACCAGCGGCAGTTATCAGCAGGACCTAGCAGTGATGGA
GCCGAAGATTGA
Transcript >OphauG2|7754
ATGCCTCACCGCGTAGCAAACTTTTTACGCACCTCGTCGGGCACCATCCCGCACATCAAGAAGAAAAAGTCGACA
ACGGCTGCCAACGACTTGTCGCGCAACAGCTCTCTCGCCCCGACGCGCAACAACTCCCTCACCACCAGCCCCGAT
GACTCCGACTCGGACGACCACCACAGCCCCAGAATAATGCCCGACCACCTGGCTGAAGCCATTCGACGCCATCAT
CGCCTCTCCTTCCCCTTTGCCCGCTCCAGTGCAAGTAGCGCCACCTCGAATTCCCACCCCGCTGCCTCGGGCCCC
GTCGGCCTCGACTGCAGTGTCGAGAGCCCGCCCATTGTCTTCCACGGCTCGCCAGAGGACAGCACCGGCGCTCTC
ATCTCGGGCCAAATGTTTCTCGACGTCCGCGCCGAAAGCGTCGACGTCGAGCGCTTTGCTGCCTGTCTCGAGATG
CGCCTCGTCCACCGCCGTCCCTTCCAGAACCACTGCTCCGACTGCCAGCGTCAGTCCACCGACCTCAAGACGTGG
CGTCTGCTGCGCCACACCACCACTCTCAAGCGTGGCCGCCACCTGTTTCCCTTTTCTGCCCTGCTCGACGGCAAG
CTCCCCGCCTCCATGGACACCCCCGTCATCTCCATCTCGTACCACTTCCGTGCCGAGGCCGTTCTTGTCCACTCG
CCCGGCTCCGGCCCCGGCTCCGCGTCGCCCTCGGCCTCGGTCACTCGCGTTTGCTTTGAGCGCCCGCTCGACGTC
AAGCGCTCGCTGCCAGAGCCGCTCTACCCCCACCACTCAGTCCGTGTCTTTCCACCCACCAACATCAAGGCTAGT
GCCCACTACAGCGCCGTCATTCACCCTACCGGCTCCAACCAGCTCACCCTCAAGCTCGACGGCCTCTTGTCTCGC
AACGAAAAGGCCCGCACCGTGGACCTGTGGCGCCTCAAGAAGCTGACATGGCGTCTCGAGGAGACTGTCAAGACT
CGTGCTCCCGCCTGTGACAAGCACGCCCCACCTGGCACCACGTCTCCTCCCCCTGCCGCCTCGGACGAAGAAACG
GCCAAGAAGACGGTGGCGCGCACCGAGACGCGCGTCCTGGGCGAGAAGCAGCTGCACGACGGGTGGAAGTCGGAC
TTTGGCGGCACCGACGGCGTCGTCGAGATGGAATTCGACTTTGGAGTCAACCAGCACCACCACCAGTCGTCCAAG
TCGGGCCCGGTTTCACGCTACGCCTGCGACACCAAGACGCCCCAGGGCACCGAAGTCACCCACTCGTTGCTCATT
GAGCTCATTGTCTCCAAGGAATACGCACCCGAGGGCAAGACCTTTTTGGCCACCCAGACTGGCACAGGCCGCATC
TTGCGAATGCATTTTGCCGTGGTCATGACTGAGTTTCCGGGCCTGGGCGTCAGCTGGGACAATGAGGCGCCTCCC
GTCTACCAAGACGTGCCGCCCAGTCCCCCGGGCTACTCGCCGTGCCGTGATGGCGAGTCGCCTGTCGAGTATGAG
GAGCTTGAGGCACTGGTTGCGCGGCGGCCGAGCTTTGACCAGCGGCAGTTATCAGCAGGACCTAGCAGTGATGGA
GCCGAAGATTGA
Gene >OphauG2|7754
ATGCCTCACCGCGTAGCAAACTTTTTACGCACCTCGTCGGGCACCATCCCGCACATCAAGAAGAAAAAGTCGACA
ACGGCTGCCAACGACTTGTCGCGCAACAGCTCTCTCGCCCCGACGCGCAACAACTCCCTCACCACCAGCCCCGAT
GACTCCGACTCGGACGACCACCACAGCCCCAGAATAATGCCCGACCACCTGGCTGAAGCCATTCGACGCCATCAT
CGCCTCTCCTTCCCCTTTGCCCGCTCCAGTGCAAGTAGCGCCACCTCGAATTCCCACCCCGCTGCCTCGGGCCCC
GTCGGCCTCGACTGCAGTGTCGAGAGCCCGCCCATTGTCTTCCACGGCTCGCCAGAGGACAGCACCGGCGCTCTC
ATCTCGGGCCAAATGTTTCTCGACGTCCGCGCCGAAAGCGTCGACGTCGAGCGCTTTGCTGCCTGTCTCGAGATG
CGCCTCGTCCACCGCCGTCCCTTCCAGAACCACTGCTCCGACTGCCAGCGTCAGTCCACCGACCTCAAGACGTGG
CGTCTGCTGCGCCACACCACCACTCTCAAGCGTGGCCGCCACCTGTTTCCCTTTTCTGCCCTGCTCGACGGCAAG
CTCCCCGCCTCCATGGACACCCCCGTCATCTCCATCTCGTACCACTTCCGTGCCGAGGCCGTTCTTGTCCACTCG
CCCGGCTCCGGCCCCGGCTCCGCGTCGCCCTCGGCCTCGGTCACTCGCGTTTGCTTTGAGCGCCCGCTCGACGTC
AAGCGCTCGCTGCCAGAGCCGCTCTACCCCCACCACTCAGTCCGTGTCTTTCCACCCACCAACATCAAGGCTAGT
GCCCACTACAGCGCCGTCATTCACCCTACCGGCTCCAACCAGCTCACCCTCAAGCTCGACGGCCTCTTGTCTCGC
AACGAAAAGGCCCGCACCGTGGACCTGTGGCGCCTCAAGAAGCTGACATGGCGTCTCGAGGAGACTGTCAAGACT
CGTGCTCCCGCCTGTGACAAGCACGCCCCACCTGGCACCACGTCTCCTCCCCCTGCCGCCTCGGACGAAGAAACG
GCCAAGAAGACGGTGGCGCGCACCGAGACGCGCGTCCTGGGCGAGAAGCAGCTGCACGACGGGTGGAAGTCGGAC
TTTGGCGGCACCGACGGCGTCGTCGAGATGGAATTCGACTTTGGAGTCAACCAGCACCACCACCAGTCGTCCAAG
TCGGGCCCGGTTTCACGCTACGCCTGCGACACCAAGACGCCCCAGGGCACCGAAGTCACCCACTCGTTGCTCATT
GAGCTCATTGTCTCCAAGGAATACGCACCCGAGGGCAAGACCTTTTTGGCCACCCAGACTGGCACAGGCCGCATC
TTGCGAATGCATTTTGCCGTGGTCATGACTGAGTTTCCGGGCCTGGGCGTCAGCTGGGACAATGAGGCGCCTCCC
GTCTACCAAGACGTGCCGCCCAGTCCCCCGGGCTACTCGCCGTGCCGTGATGGCGAGTCGCCTGTCGAGTATGAG
GAGCTTGAGGCACTGGTTGCGCGGCGGCCGAGCTTTGACCAGCGGCAGTTATCAGCAGGACCTAGCAGTGATGGA
GCCGAAGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail