Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|775
Gene name
LocationContig_12:44229..45861
Strand-
Gene length (bp)1632
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10287 YJL171C_Tos1_C Cell wall protein YJL171C/Tos1, C-terminal 2.0E-89 241 461
PF10290 YJL171C_Tos1_N Cell wall protein YJL171C/Tos1, N-terminal 9.7E-16 42 101

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AQ83|PGA52_ARTBC PGA52-like protein ARB_06390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06390 PE=3 SV=1 29 459 1.0E-74
sp|P38288|TOS1_YEAST Protein TOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS1 PE=1 SV=1 32 462 3.0E-67
sp|Q9P7X4|YH6B_SCHPO Uncharacterized serine-rich protein P23A10.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.11c PE=2 SV=1 24 479 3.0E-59
sp|P46992|YJR1_YEAST Cell wall protein YJL171C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL171C PE=1 SV=2 241 473 3.0E-34
sp|Q59L72|PGA52_CANAL GPI-anchored protein 52 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA52 PE=1 SV=1 241 463 4.0E-32

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|775
MKCFLACLVASAGSAWGLTQQCSAEKAVNESGNWFCGNVEHILYEGLPRGSWSYDEVVEMSPEGKCIVREKQYNG
PLGPLAQDLSIHMRGPLNLKQAAVYTFSSECKAKSRRSRLRRSVARKDHKRAVWVTATIDGKVVSWVNNWFGQPA
AASSVAPSPASPGETIFVTSTTVTLVEAAAATARSSGPSVQTSTGPSMAASTAQSSALPTTSSEPRPFSQHELPE
APVDQDDIPETPVECDWERVAYYSAEKQHAENIMFMGNYGGQGSGVWDKVWGNSLSYLNADGTAGSASPQILKNV
ELKSNQEFSIFSAEKCDESCGFSRVPEMAYKGFGGANKVFLFHFNMPFDGNRGFNGDKPAIWALNAQIPRTSQYT
ACSCWRSGCGEVDIYEVLAPGDNKCKSTFHLASRSGGSSDWFERPADSFIKVAVVFDHASASVSIHRLDDGVDFS
QSLDQETVQSWLRGTTKHQTLRSLFQMSS*
Coding >OphauG2|775
ATGAAGTGCTTTCTGGCTTGTCTTGTCGCCTCGGCGGGCTCGGCGTGGGGCCTGACACAGCAGTGTTCTGCCGAA
AAGGCCGTCAATGAGAGCGGCAACTGGTTCTGCGGCAACGTTGAGCATATTCTGTACGAGGGCCTGCCCAGGGGA
AGCTGGAGCTACGACGAGGTGGTGGAAATGAGTCCCGAGGGAAAATGCATCGTGCGGGAGAAGCAGTATAACGGT
CCCCTAGGCCCGCTGGCCCAAGACTTGTCTATCCACATGCGTGGCCCGTTGAATCTCAAACAAGCAGCTGTGTAT
ACCTTTTCCTCAGAGTGCAAGGCCAAGTCCCGGCGCTCGCGGCTTCGTCGAAGCGTGGCCAGAAAAGACCACAAG
AGAGCTGTTTGGGTCACCGCCACCATTGACGGCAAAGTCGTCTCGTGGGTGAATAACTGGTTTGGCCAGCCTGCT
GCAGCGTCGTCCGTTGCGCCTTCTCCGGCCTCGCCAGGAGAGACCATCTTCGTTACCAGCACAACCGTCACGCTG
GTCGAGGCTGCTGCTGCCACTGCTCGCTCGTCTGGACCGTCTGTGCAGACAAGTACAGGGCCGTCCATGGCTGCG
AGTACTGCCCAGTCCAGCGCACTGCCCACCACAAGCAGCGAACCTAGGCCATTTTCCCAGCATGAGCTTCCTGAG
GCGCCTGTCGACCAAGACGACATTCCCGAGACGCCTGTAGAATGCGATTGGGAGCGCGTAGCCTACTATAGTGCC
GAGAAACAGCATGCCGAAAACATCATGTTCATGGGCAACTATGGCGGGCAAGGCTCTGGCGTATGGGACAAGGTT
TGGGGAAACTCGCTCTCATATCTCAACGCCGACGGGACCGCAGGCTCCGCATCGCCTCAGATTCTCAAAAACGTT
GAGCTCAAGTCGAATCAGGAATTCTCCATCTTTAGCGCGGAAAAGTGTGACGAGAGCTGTGGCTTCTCGCGCGTT
CCAGAAATGGCCTATAAGGGCTTTGGCGGCGCAAACAAAGTCTTTCTCTTCCACTTCAACATGCCCTTTGACGGC
AACAGGGGCTTCAACGGCGACAAGCCCGCCATCTGGGCTCTCAACGCACAGATACCGCGCACCAGCCAGTACACA
GCATGCAGCTGCTGGCGCTCCGGCTGCGGAGAAGTCGACATTTATGAGGTGCTCGCCCCCGGCGACAACAAGTGC
AAAAGCACCTTTCACCTGGCCAGCCGCAGCGGCGGCAGCTCCGACTGGTTCGAGCGCCCAGCCGACTCCTTTATC
AAAGTGGCTGTTGTCTTTGACCATGCGTCTGCCAGTGTCTCGATCCACCGCCTCGACGATGGTGTTGATTTTTCC
CAGAGCCTCGACCAAGAGACGGTTCAGTCTTGGCTGCGTGGAACCACCAAGCACCAAACGCTGCGCAGTCTGTTC
CAAATGTCTTCATAA
Transcript >OphauG2|775
ATGAAGTGCTTTCTGGCTTGTCTTGTCGCCTCGGCGGGCTCGGCGTGGGGCCTGACACAGCAGTGTTCTGCCGAA
AAGGCCGTCAATGAGAGCGGCAACTGGTTCTGCGGCAACGTTGAGCATATTCTGTACGAGGGCCTGCCCAGGGGA
AGCTGGAGCTACGACGAGGTGGTGGAAATGAGTCCCGAGGGAAAATGCATCGTGCGGGAGAAGCAGTATAACGGT
CCCCTAGGCCCGCTGGCCCAAGACTTGTCTATCCACATGCGTGGCCCGTTGAATCTCAAACAAGCAGCTGTGTAT
ACCTTTTCCTCAGAGTGCAAGGCCAAGTCCCGGCGCTCGCGGCTTCGTCGAAGCGTGGCCAGAAAAGACCACAAG
AGAGCTGTTTGGGTCACCGCCACCATTGACGGCAAAGTCGTCTCGTGGGTGAATAACTGGTTTGGCCAGCCTGCT
GCAGCGTCGTCCGTTGCGCCTTCTCCGGCCTCGCCAGGAGAGACCATCTTCGTTACCAGCACAACCGTCACGCTG
GTCGAGGCTGCTGCTGCCACTGCTCGCTCGTCTGGACCGTCTGTGCAGACAAGTACAGGGCCGTCCATGGCTGCG
AGTACTGCCCAGTCCAGCGCACTGCCCACCACAAGCAGCGAACCTAGGCCATTTTCCCAGCATGAGCTTCCTGAG
GCGCCTGTCGACCAAGACGACATTCCCGAGACGCCTGTAGAATGCGATTGGGAGCGCGTAGCCTACTATAGTGCC
GAGAAACAGCATGCCGAAAACATCATGTTCATGGGCAACTATGGCGGGCAAGGCTCTGGCGTATGGGACAAGGTT
TGGGGAAACTCGCTCTCATATCTCAACGCCGACGGGACCGCAGGCTCCGCATCGCCTCAGATTCTCAAAAACGTT
GAGCTCAAGTCGAATCAGGAATTCTCCATCTTTAGCGCGGAAAAGTGTGACGAGAGCTGTGGCTTCTCGCGCGTT
CCAGAAATGGCCTATAAGGGCTTTGGCGGCGCAAACAAAGTCTTTCTCTTCCACTTCAACATGCCCTTTGACGGC
AACAGGGGCTTCAACGGCGACAAGCCCGCCATCTGGGCTCTCAACGCACAGATACCGCGCACCAGCCAGTACACA
GCATGCAGCTGCTGGCGCTCCGGCTGCGGAGAAGTCGACATTTATGAGGTGCTCGCCCCCGGCGACAACAAGTGC
AAAAGCACCTTTCACCTGGCCAGCCGCAGCGGCGGCAGCTCCGACTGGTTCGAGCGCCCAGCCGACTCCTTTATC
AAAGTGGCTGTTGTCTTTGACCATGCGTCTGCCAGTGTCTCGATCCACCGCCTCGACGATGGTGTTGATTTTTCC
CAGAGCCTCGACCAAGAGACGGTTCAGTCTTGGCTGCGTGGAACCACCAAGCACCAAACGCTGCGCAGTCTGTTC
CAAATGTCTTCATAA
Gene >OphauG2|775
ATGAAGTGCTTTCTGGCTTGTCTTGTCGCCTCGGCGGGCTCGGCGTGGGGCCTGACACAGCAGTGTTCTGCCGAA
AAGGCCGTCAATGAGAGCGGCAACTGGTTCTGCGGCAACGTTGAGCATATTCTGTACGAGGGCCTGCCCAGGGGA
AGCTGGAGCTACGACGAGGTGGTGGAAATGAGTCCCGAGGGAAAATGCATCGTGCGGGAGAAGCAGTATAACGGT
CCCCTAGGCCCGCTGGCCCAAGACGTGAGCTGGCTTATACTCGGCCCCGTCGTTTCCTCAGGGCGAGCTTGCTGA
TGCGATCCTAGTTGTCTATCCACATGCGTGGCCCGTTGAATCTCAAACAAGCAGCTGTGTATACCTTTTCCTCAG
AGTGCAAGGCCAAGTCCCGGCGCTCGCGGCTTCGTCGAAGCGTGGCCAGAAAAGACCACAAGAGAGCTGTTTGGG
TCACCGCCACCATTGACGGCAAAGTCGTCTCGTGGGTGAATAACTGGTTTGGCCAGCCTGCTGCAGCGTCGTCCG
TTGCGCCTTCTCCGGCCTCGCCAGGAGAGACCATCTTCGTTACCAGCACAACCGTCACGCTGGTCGAGGCTGCTG
CTGCCACTGCTCGCTCGTCTGGACCGTCTGTGCAGACAAGTACAGGGCCGTCCATGGCTGCGAGTACTGCCCAGT
CCAGCGCACTGCCCACCACAAGCAGCGAACCTAGGCCATTTTCCCAGCATGAGCTTCCTGAGGCGCCTGTCGACC
AAGACGACATTCCCGAGACGCCTGTAGAATGCGATTGGGAGCGCGTAGCCTACTATAGTGCCGAGAAACAGCATG
CCGAAAACATCATGTTCATGGGCAACTATGGCGGGCAAGGCTCTGGCGTATGGGACAAGTAGGAAACCCCCAGGG
GTGAATCCAATTCTCCCTGTGCTGACTCTCTGCTTGCCCCTAGGGTTTGGGGAAACTCGCTCTCATATCTCAACG
CCGACGGGACCGCAGGCTCCGCATCGCCTCAGATTCTCAAAAACGTTGAGCTCAAGTCGAATCAGGAATTCTCCA
TCTTTAGCGCGGAAAAGTGTGACGAGAGCTGTGGCTTCTCGCGCGTTCCAGAAATGGCCTATAGTGAGTGGCACG
GCAAATACTTTTTTTTTTTATTTTGCTCTTGAAATTCCCGCTGCTAACCCTCCCACAGAGGGCTTTGGCGGCGCA
AACAAAGTCTTTCTCTTCCACTTCAACATGCCCTTTGACGGCAACAGGGGCTTCAACGGCGACAAGCCCGCCATC
TGGGCTCTCAACGCACAGATACCGCGCACCAGCCAGTACACAGCATGCAGCTGCTGGCGCTCCGGCTGCGGAGAA
GTCGACATTTATGAGGTGCTCGCCCCCGGCGACAACAAGTGCAAAAGCACCTTTCACCTGGCCAGCCGCAGCGGC
GGCAGCTCCGACTGGTTCGAGCGCCCAGCCGACTCCTTTATCAAAGTGGCTGTTGTCTTTGACCATGCGTCTGCC
AGTGTCTCGATCCACCGCCTCGACGATGGTGTTGATTTTTCCCAGAGCCTCGACCAAGAGACGGTTCAGTCTTGG
CTGCGTGGAACCACCAAGCACCAAACGCTGCGCAGTCTGTTCCAAATGTCTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail