Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7731
Gene name
LocationContig_93:28267..29380
Strand+
Gene length (bp)1113
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit 7.8E-38 126 242
PF00575 S1 S1 RNA binding domain 4.9E-13 14 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56286|IF2A_SCHPO Eukaryotic translation initiation factor 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif211 PE=1 SV=1 1 302 7.0E-139
sp|P20459|IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI2 PE=1 SV=1 1 295 5.0E-136
sp|Q5ZLX2|IF2A_CHICK Eukaryotic translation initiation factor 2 subunit 1 OS=Gallus gallus GN=EIF2S1 PE=2 SV=2 1 302 7.0E-108
sp|P05198|IF2A_HUMAN Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens GN=EIF2S1 PE=1 SV=3 1 302 9.0E-108
sp|Q6GL89|IF2A_XENTR Eukaryotic translation initiation factor 2 subunit 1 OS=Xenopus tropicalis GN=eif2s1 PE=2 SV=1 1 302 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56286|IF2A_SCHPO Eukaryotic translation initiation factor 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif211 PE=1 SV=1 1 302 7.0E-139
sp|P20459|IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI2 PE=1 SV=1 1 295 5.0E-136
sp|Q5ZLX2|IF2A_CHICK Eukaryotic translation initiation factor 2 subunit 1 OS=Gallus gallus GN=EIF2S1 PE=2 SV=2 1 302 7.0E-108
sp|P05198|IF2A_HUMAN Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens GN=EIF2S1 PE=1 SV=3 1 302 9.0E-108
sp|Q6GL89|IF2A_XENTR Eukaryotic translation initiation factor 2 subunit 1 OS=Xenopus tropicalis GN=eif2s1 PE=2 SV=1 1 302 2.0E-107
sp|Q5R493|IF2A_PONAB Eukaryotic translation initiation factor 2 subunit 1 OS=Pongo abelii GN=EIF2S1 PE=2 SV=1 1 302 2.0E-107
sp|P68101|IF2A_RAT Eukaryotic translation initiation factor 2 subunit 1 OS=Rattus norvegicus GN=Eif2s1 PE=1 SV=2 1 302 5.0E-107
sp|Q6ZWX6|IF2A_MOUSE Eukaryotic translation initiation factor 2 subunit 1 OS=Mus musculus GN=Eif2s1 PE=1 SV=3 1 302 5.0E-107
sp|P68102|IF2A_BOVIN Eukaryotic translation initiation factor 2 subunit 1 OS=Bos taurus GN=EIF2S1 PE=2 SV=2 1 302 5.0E-107
sp|Q7ZTK4|IF2A_XENLA Eukaryotic translation initiation factor 2 subunit 1 OS=Xenopus laevis GN=eif2s1 PE=2 SV=1 1 310 8.0E-107
sp|P41374|IF2A_DROME Eukaryotic translation initiation factor 2 subunit 1 OS=Drosophila melanogaster GN=eIF-2alpha PE=2 SV=1 1 298 3.0E-93
sp|Q869N9|IF2A_DICDI Eukaryotic translation initiation factor 2 subunit 1 OS=Dictyostelium discoideum GN=eif2s1 PE=1 SV=1 5 295 4.0E-89
sp|P20460|IF2A_PIG Eukaryotic translation initiation factor 2 subunit 1 (Fragment) OS=Sus scrofa GN=EIF2S1 PE=1 SV=2 5 67 9.0E-27
sp|Q57581|IF2A_METJA Translation initiation factor 2 subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eif2a PE=3 SV=1 13 274 5.0E-23
sp|Q973G0|IF2A_SULTO Translation initiation factor 2 subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eif2a PE=3 SV=1 14 233 3.0E-22
sp|B6YT35|IF2A_THEON Translation initiation factor 2 subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=eif2a PE=3 SV=1 13 269 4.0E-21
sp|C5A4Z9|IF2A_THEGJ Translation initiation factor 2 subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=eif2a PE=3 SV=1 13 269 1.0E-20
sp|Q5JE49|IF2A_THEKO Translation initiation factor 2 subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif2a PE=3 SV=1 13 269 3.0E-20
sp|Q8U1R5|IF2A_PYRFU Translation initiation factor 2 subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eif2a PE=3 SV=1 13 269 3.0E-20
sp|O58655|IF2A_PYRHO Translation initiation factor 2 subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eif2a PE=1 SV=1 13 269 1.0E-19
sp|Q9V0E4|IF2A_PYRAB Translation initiation factor 2 subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eif2a PE=1 SV=1 13 269 2.0E-19
sp|A2BN93|IF2A_HYPBU Translation initiation factor 2 subunit alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=eif2a PE=3 SV=1 14 241 5.0E-19
sp|P83268|IF2A_RABIT Eukaryotic translation initiation factor 2 subunit 1 (Fragment) OS=Oryctolagus cuniculus GN=EIF2S1 PE=1 SV=1 5 53 3.0E-17
sp|Q8TY86|IF2A_METKA Translation initiation factor 2 subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eif2a PE=3 SV=1 14 265 1.0E-16
sp|A5UMB0|IF2A_METS3 Translation initiation factor 2 subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=eif2a PE=3 SV=1 11 241 5.0E-16
sp|Q97Z79|IF2A_SULSO Translation initiation factor 2 subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eif2a PE=1 SV=1 8 258 1.0E-15
sp|A3DM89|IF2A_STAMF Translation initiation factor 2 subunit alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=eif2a PE=3 SV=1 14 251 3.0E-15
sp|O29723|IF2A_ARCFU Translation initiation factor 2 subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eif2a PE=3 SV=1 13 265 2.0E-14
sp|O27363|IF2A_METTH Translation initiation factor 2 subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eif2a PE=3 SV=1 13 265 2.0E-14
sp|Q2NE59|IF2A_METST Translation initiation factor 2 subunit alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=eif2a PE=3 SV=1 12 252 2.0E-13
sp|Q5UX22|IF2A_HALMA Translation initiation factor 2 subunit alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif2a PE=3 SV=1 13 266 3.0E-12
sp|C3NDP3|IF2A_SULIY Translation initiation factor 2 subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=eif2a PE=3 SV=1 8 258 5.0E-10
sp|C3NI08|IF2A_SULIN Translation initiation factor 2 subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=eif2a PE=3 SV=1 8 258 5.0E-10
sp|C3MYF1|IF2A_SULIM Translation initiation factor 2 subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=eif2a PE=3 SV=1 8 258 7.0E-10
sp|C4KGP8|IF2A_SULIK Translation initiation factor 2 subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=eif2a PE=3 SV=1 8 258 7.0E-10
sp|C3N545|IF2A_SULIA Translation initiation factor 2 subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=eif2a PE=3 SV=1 8 258 7.0E-10
sp|C3MPG3|IF2A_SULIL Translation initiation factor 2 subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eif2a PE=3 SV=1 8 258 8.0E-10
sp|Q9YF02|IF2A_AERPE Translation initiation factor 2 subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eif2a PE=3 SV=3 14 155 1.0E-09
sp|Q8ZTY5|IF2A_PYRAE Translation initiation factor 2 subunit alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=eif2a PE=3 SV=1 6 233 2.0E-09
sp|Q9HRT8|IF2A_HALSA Translation initiation factor 2 subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eif2a PE=3 SV=1 11 235 1.0E-06
sp|B0R3M0|IF2A_HALS3 Translation initiation factor 2 subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eif2a PE=3 SV=1 11 235 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0003676 nucleic acid binding Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0045182 translation regulator activity No
GO:1901363 heterocyclic compound binding No
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4031
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7731 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5900
Ophiocordyceps camponoti-floridani Ophcf2|02830
Ophiocordyceps camponoti-rufipedis Ophun1|6541
Ophiocordyceps kimflemingae Ophio5|252
Ophiocordyceps subramaniannii Hirsu2|8109

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7731
MSLTNCRFYEEKYPEIDSFVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQKLIRVGRNEVVVVLR
VDKEKGYIDLSKRRVSPEDMVKCEERYNKSKTVHLIMRHVAEKTQTPIESLYETIAWPLNRKFGHALDAFKLSIT
NPEVWNDTTFTSPAVEEELKSYIGKRLTPQKAKVRADIEVTCFGYEGIDAVKTALRTAEAGNAVEEDNSGTEVKV
KLVSPPLYVLTSTCLDKNEGIKRLQESIMDIRKSIEAAGGNLTVKMEPKAVTESDDAELQALMEKRERENAEVSG
DESLSDSDDIPQTV*
Coding >OphauG2|7731
ATGTCGTTAACAAACTGTCGTTTCTATGAAGAGAAATATCCGGAGATTGATAGCTTCGTCATGGTCAATGTGAAG
CAGATCGCCGAAATGGGTGCCTACGTTAAGCTACTCGAGTACGATAATATTGACGGCATGATTCTACTGTCCGAG
TTGTCTCGAAGACGTATTCGCTCCATTCAAAAGCTCATTAGAGTTGGACGTAACGAAGTGGTTGTTGTGCTTCGC
GTCGACAAAGAAAAGGGCTATATCGATCTTTCAAAACGCCGAGTCTCGCCTGAGGATATGGTCAAGTGTGAGGAG
CGGTATAATAAGAGCAAGACGGTCCACCTTATTATGCGTCATGTTGCGGAAAAGACACAGACGCCCATCGAGTCC
CTATACGAGACCATCGCGTGGCCCCTGAACCGGAAATTTGGGCACGCTCTCGATGCCTTCAAGCTCTCAATTACC
AATCCCGAAGTTTGGAACGACACTACCTTTACCAGCCCAGCTGTCGAGGAAGAGCTAAAATCTTACATCGGCAAG
CGTCTCACCCCTCAAAAGGCCAAGGTCCGAGCCGACATTGAGGTGACATGCTTTGGTTATGAGGGAATCGACGCC
GTCAAAACGGCGCTACGTACTGCTGAAGCAGGAAACGCTGTCGAAGAAGACAATTCGGGGACTGAGGTCAAGGTG
AAGCTTGTCTCTCCACCTTTGTATGTCCTGACCAGCACCTGCTTGGATAAGAATGAGGGCATCAAACGACTACAG
GAGTCTATCATGGACATTCGCAAGAGTATCGAAGCAGCAGGCGGCAACCTGACGGTCAAGATGGAACCCAAGGCT
GTCACGGAGAGCGACGATGCCGAATTGCAGGCGCTCATGGAGAAGCGCGAGCGCGAAAACGCCGAGGTTAGCGGG
GACGAGAGCTTGAGTGACAGCGATGATATCCCCCAGACTGTTTGA
Transcript >OphauG2|7731
ATGTCGTTAACAAACTGTCGTTTCTATGAAGAGAAATATCCGGAGATTGATAGCTTCGTCATGGTCAATGTGAAG
CAGATCGCCGAAATGGGTGCCTACGTTAAGCTACTCGAGTACGATAATATTGACGGCATGATTCTACTGTCCGAG
TTGTCTCGAAGACGTATTCGCTCCATTCAAAAGCTCATTAGAGTTGGACGTAACGAAGTGGTTGTTGTGCTTCGC
GTCGACAAAGAAAAGGGCTATATCGATCTTTCAAAACGCCGAGTCTCGCCTGAGGATATGGTCAAGTGTGAGGAG
CGGTATAATAAGAGCAAGACGGTCCACCTTATTATGCGTCATGTTGCGGAAAAGACACAGACGCCCATCGAGTCC
CTATACGAGACCATCGCGTGGCCCCTGAACCGGAAATTTGGGCACGCTCTCGATGCCTTCAAGCTCTCAATTACC
AATCCCGAAGTTTGGAACGACACTACCTTTACCAGCCCAGCTGTCGAGGAAGAGCTAAAATCTTACATCGGCAAG
CGTCTCACCCCTCAAAAGGCCAAGGTCCGAGCCGACATTGAGGTGACATGCTTTGGTTATGAGGGAATCGACGCC
GTCAAAACGGCGCTACGTACTGCTGAAGCAGGAAACGCTGTCGAAGAAGACAATTCGGGGACTGAGGTCAAGGTG
AAGCTTGTCTCTCCACCTTTGTATGTCCTGACCAGCACCTGCTTGGATAAGAATGAGGGCATCAAACGACTACAG
GAGTCTATCATGGACATTCGCAAGAGTATCGAAGCAGCAGGCGGCAACCTGACGGTCAAGATGGAACCCAAGGCT
GTCACGGAGAGCGACGATGCCGAATTGCAGGCGCTCATGGAGAAGCGCGAGCGCGAAAACGCCGAGGTTAGCGGG
GACGAGAGCTTGAGTGACAGCGATGATATCCCCCAGACTGTTTGA
Gene >OphauG2|7731
ATGTCGTTAACAAACTGTCGTTTCTATGAAGAGAAATATCCGGAGATTGATAGCTTCGTCATGGTCAATGTGAAG
CAGGTGCGTTGAACTACCACTGATCAGCACGTGCTCGACACTGGGCTTATTGTTTGCGCAGATCGCCGAAATGGG
TGCCTACGTTAAGCTACTCGAGTACGATAATATTGACGGCATGATTCTACTGTCCGAGTTGTCTCGAAGACGTAT
TCGCTCCATTCAAAAGCTCATTAGAGTTGGACGTAACGAAGTGGTTGTTGTGCTTCGCGTCGACAAAGAAAAGGG
TAAACTCCCTTTCCAGAAACGGCTATTTTTCCGAACCTAACTTTGAAGTAACAAGGCTATATCGATCTTTCAAAA
CGCCGAGTCTCGCCTGAGGATATGGTCAAGTGTGAGGAGCGGTATAATAAGAGCAAGACGGTCCACCTTATTATG
CGTCATGTTGCGGAAAAGACACAGACGCCCATCGAGTCCCTATACGAGACCATCGCGTGGCCCCTGAACCGGAAA
TTTGGGCACGCTCTCGATGCCTTCAAGCTCTCAATTACGTGAGTCCGGGATTCTCGATGGCAAGTTGGCATTATA
CTCATCAAGGCCATCAGCAATCCCGAAGTTTGGAACGACACTACCTTTACCAGCCCAGCTGTCGAGGAAGAGCTA
AAATCTTACATCGGCAAGCGTCTCACCCCTCAAAAGGCCAAGGTCCGAGCCGACATTGAGGTGACATGCTTTGGT
TATGAGGGAATCGACGCCGTCAAAACGGCGCTACGTACTGCTGAAGCAGGAAACGCTGTCGAAGAAGACAATTCG
GGGACTGAGGTCAAGGTGAAGCTTGTCTCTCCACCTTTGTATGTCCTGACCAGCACCTGCTTGGATAAGAATGAG
GGCATCAAACGACTACAGGAGTCTATCATGGACATTCGCAAGAGTATCGAAGCAGCAGGCGGCAACCTGACGGTC
AAGATGGAACCCAAGGCTGTCACGGAGAGCGACGATGCCGAATTGCAGGCGCTCATGGAGAAGCGCGAGCGCGAA
AACGCCGAGGTTAGCGGGGACGAGAGCTTGAGTGACAGCGATGATATCCCCCAGACTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail