Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7719
Gene name
LocationContig_93:484..997
Strand+
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 6.1E-28 22 140

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HFP8|MP1_ASPFM Cell wall mannoprotein 1 OS=Neosartorya fumigata GN=MP1 PE=1 SV=1 1 169 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7719
MLFSHALVALAAIVSPVLADGAAINASISAIRADVVQLGTVTADWNGKLLGALPIVAEAGRLYKDLKKGTRTADA
SAPLTTDEALGIATSTGQLAGEVNKTLDIIIAAKPKFDHLLLGPIILVTLETEQDATEEFADAVVAKVPKDLAPV
AVNIIQGIKDSFAKAISAYS*
Coding >OphauG2|7719
ATGCTCTTCTCGCACGCCCTTGTCGCCCTGGCAGCAATTGTCTCGCCCGTCCTTGCCGACGGCGCCGCCATCAAT
GCCTCGATATCAGCCATCAGGGCCGACGTGGTTCAACTCGGCACAGTAACTGCAGACTGGAACGGCAAGCTCCTC
GGCGCCCTGCCCATCGTCGCCGAGGCCGGCCGCCTGTACAAGGATCTCAAAAAGGGCACCCGCACAGCCGATGCC
TCTGCTCCCCTAACCACGGATGAGGCTCTCGGCATAGCCACCTCGACGGGCCAGCTCGCCGGCGAGGTCAACAAG
ACGCTCGACATTATAATTGCCGCCAAGCCAAAATTTGATCATCTGCTTCTCGGCCCCATTATACTGGTTACCCTC
GAGACCGAACAGGACGCCACCGAAGAGTTTGCAGACGCAGTTGTGGCAAAGGTGCCCAAGGACCTGGCGCCTGTT
GCCGTGAATATCATCCAAGGCATCAAAGACAGCTTTGCCAAAGCCATTAGCGCATATAGCTGA
Transcript >OphauG2|7719
ATGCTCTTCTCGCACGCCCTTGTCGCCCTGGCAGCAATTGTCTCGCCCGTCCTTGCCGACGGCGCCGCCATCAAT
GCCTCGATATCAGCCATCAGGGCCGACGTGGTTCAACTCGGCACAGTAACTGCAGACTGGAACGGCAAGCTCCTC
GGCGCCCTGCCCATCGTCGCCGAGGCCGGCCGCCTGTACAAGGATCTCAAAAAGGGCACCCGCACAGCCGATGCC
TCTGCTCCCCTAACCACGGATGAGGCTCTCGGCATAGCCACCTCGACGGGCCAGCTCGCCGGCGAGGTCAACAAG
ACGCTCGACATTATAATTGCCGCCAAGCCAAAATTTGATCATCTGCTTCTCGGCCCCATTATACTGGTTACCCTC
GAGACCGAACAGGACGCCACCGAAGAGTTTGCAGACGCAGTTGTGGCAAAGGTGCCCAAGGACCTGGCGCCTGTT
GCCGTGAATATCATCCAAGGCATCAAAGACAGCTTTGCCAAAGCCATTAGCGCATATAGCTGA
Gene >OphauG2|7719
ATGCTCTTCTCGCACGCCCTTGTCGCCCTGGCAGCAATTGTCTCGCCCGTCCTTGCCGACGGCGCCGCCATCAAT
GCCTCGATATCAGCCATCAGGGCCGACGTGGTTCAACTCGGCACAGTAACTGCAGACTGGAACGGCAAGCTCCTC
GGCGCCCTGCCCATCGTCGCCGAGGCCGGCCGCCTGTACAAGGATCTCAAAAAGGGCACCCGCACAGCCGATGCC
TCTGCTCCCCTAACCACGGATGAGGCTCTCGGCATAGCCACCTCGACGGGCCAGCTCGCCGGCGAGGTCAACAAG
ACGCTCGACATTATAATTGCCGCCAAGCCAAAATTTGATCATCTGCTTCTCGGCCCCATTATACTGGTTACCCTC
GAGACCGAACAGGACGCCACCGAAGAGTTTGCAGACGCAGTTGTGGCAAAGGTGCCCAAGGACCTGGCGCCTGTT
GCCGTGAATATCATCCAAGGCATCAAAGACAGCTTTGCCAAAGCCATTAGCGCATATAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail