Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7707
Gene name
LocationContig_924:2073..2889
Strand+
Gene length (bp)816
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 2.7E-18 32 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 30 223 1.0E-09
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 12 266 4.0E-08
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 30 193 3.0E-07
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 25 265 3.0E-07
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 30 234 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 30 223 1.0E-09
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 12 266 4.0E-08
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 30 193 3.0E-07
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 25 265 3.0E-07
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 30 234 8.0E-07
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 25 265 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup805
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6027
Ophiocordyceps australis 1348a (Ghana) OphauG2|7707 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1941
Ophiocordyceps australis map64 (Brazil) OphauB2|276
Ophiocordyceps australis map64 (Brazil) OphauB2|4675
Ophiocordyceps camponoti-floridani Ophcf2|00177
Ophiocordyceps camponoti-rufipedis Ophun1|4506
Ophiocordyceps subramaniannii Hirsu2|361

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7707
MLPILDPAVPWHQTLDAASRLAGRRISNGAELRALDSETLINANREVIAKAKPGTFAYGPSPDGGYLPDMPGVLL
REGRFDAAPKMMLGYNLNEGDFFVPAEVVSAEEVKSFLQNAIPGIPSDQLDYITGTLYPHAPQHGLYQTERERAA
HIISEVYFTCNTRFMGTAYGNQTYNYRFQVGEAEHGQDVVYTFYTGLDYSAPAQLAKKMQLYLTKFAQFGSPNHA
SSLPEWPVYGKGANIVTFGGQQDVGVDVDAAKNHRCAYWQSRKWMG*
Coding >OphauG2|7707
ATGCTCCCCATTCTTGACCCCGCGGTTCCATGGCACCAGACGCTTGATGCTGCGAGTCGGCTCGCGGGTCGAAGG
ATTAGCAACGGCGCTGAGCTGCGAGCCCTCGACTCGGAGACGCTTATCAATGCCAATCGCGAGGTTATTGCAAAG
GCGAAGCCTGGCACGTTTGCATATGGGCCCAGTCCTGACGGTGGCTATCTACCCGACATGCCTGGTGTTTTGCTG
CGTGAGGGGAGGTTTGATGCTGCTCCCAAGATGATGCTTGGCTATAATTTGAACGAGGGCGATTTTTTTGTTCCC
GCCGAGGTGGTGAGCGCTGAAGAAGTAAAGTCTTTTCTTCAAAACGCCATTCCCGGAATCCCGAGTGATCAGCTC
GACTATATAACTGGTACACTCTATCCTCATGCGCCTCAGCACGGTCTCTACCAGACGGAGCGTGAGCGAGCAGCC
CACATCATATCAGAAGTCTACTTTACGTGCAACACAAGATTCATGGGCACGGCATACGGTAACCAGACTTACAAC
TACCGCTTCCAAGTCGGCGAGGCTGAGCACGGCCAAGATGTGGTGTATACATTTTACACCGGCCTGGACTACAGT
GCGCCAGCACAGCTGGCAAAAAAGATGCAGCTTTATCTGACAAAGTTTGCGCAGTTTGGCTCCCCAAACCATGCT
AGCTCGTTGCCCGAGTGGCCCGTGTACGGCAAGGGGGCTAATATTGTTACTTTTGGGGGACAGCAGGACGTGGGT
GTAGACGTTGATGCTGCCAAGAATCATCGGTGTGCATACTGGCAGTCACGAAAGTGGATGGGCTGA
Transcript >OphauG2|7707
ATGCTCCCCATTCTTGACCCCGCGGTTCCATGGCACCAGACGCTTGATGCTGCGAGTCGGCTCGCGGGTCGAAGG
ATTAGCAACGGCGCTGAGCTGCGAGCCCTCGACTCGGAGACGCTTATCAATGCCAATCGCGAGGTTATTGCAAAG
GCGAAGCCTGGCACGTTTGCATATGGGCCCAGTCCTGACGGTGGCTATCTACCCGACATGCCTGGTGTTTTGCTG
CGTGAGGGGAGGTTTGATGCTGCTCCCAAGATGATGCTTGGCTATAATTTGAACGAGGGCGATTTTTTTGTTCCC
GCCGAGGTGGTGAGCGCTGAAGAAGTAAAGTCTTTTCTTCAAAACGCCATTCCCGGAATCCCGAGTGATCAGCTC
GACTATATAACTGGTACACTCTATCCTCATGCGCCTCAGCACGGTCTCTACCAGACGGAGCGTGAGCGAGCAGCC
CACATCATATCAGAAGTCTACTTTACGTGCAACACAAGATTCATGGGCACGGCATACGGTAACCAGACTTACAAC
TACCGCTTCCAAGTCGGCGAGGCTGAGCACGGCCAAGATGTGGTGTATACATTTTACACCGGCCTGGACTACAGT
GCGCCAGCACAGCTGGCAAAAAAGATGCAGCTTTATCTGACAAAGTTTGCGCAGTTTGGCTCCCCAAACCATGCT
AGCTCGTTGCCCGAGTGGCCCGTGTACGGCAAGGGGGCTAATATTGTTACTTTTGGGGGACAGCAGGACGTGGGT
GTAGACGTTGATGCTGCCAAGAATCATCGGTGTGCATACTGGCAGTCACGAAAGTGGATGGGCTGA
Gene >OphauG2|7707
ATGCTCCCCATTCTTGACCCCGCGGTTCCATGGCACCAGACGCTTGATGCTGCGAGTCGGCTCGCGGGTCGAAGG
ATTAGCAACGGCGCTGAGCTGCGAGCCCTCGACTCGGAGACGCTTATCAATGCCAATCGCGAGGTTATTGCAAAG
GCGAAGCCTGGCACGTTTGCATATGGGCCCAGTCCTGACGGTGGCTATCTACCCGACATGCCTGGTGTTTTGCTG
CGTGAGGGGAGGTTTGATGCTGCTCCCAAGATGATGCTTGGCTATAATTTGAACGAGGGCGATTTTTTTGTTCCC
GCCGAGGTGGTGAGCGCTGAAGAAGTAAAGTCTTTTCTTCAAAACGCCATTCCCGGAATCCCGAGTGATCAGCTC
GACTATATAACTGGTACACTCTATCCTCATGCGCCTCAGCACGGTCTCTACCAGACGGAGCGTGAGCGAGCAGCC
CACATCATATCAGAAGTCTACTTTACGTGCAACACAAGATTCATGGGCACGGCATACGGTAACCAGACTTACAAC
TACCGCTTCCAAGTCGGCGAGGCTGAGCACGGCCAAGATGTGGTGTATACATTTTACACCGGCCTGGACTACAGT
GCGCCAGCACAGCTGGCAAAAAAGATGCAGCTTTATCTGACAAAGTTTGCGCAGTTTGGCTCCCCAAACCATGCT
AGCTCGTTGCCCGAGTGGCCCGTGTACGGCAAGGGGGCTAATATTGTTACTTTTGGGGGACAGCAGGACGTGGGT
GTAGACGTTGATGCTGCCAAGAATCATCGGTGTGCATACTGGCAGTCACGAAAGTGGATGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail