Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7705
Gene name
LocationContig_923:2786..3700
Strand+
Gene length (bp)914
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03366 YEATS YEATS family 6.4E-30 42 126
PF20305 pYEATS prokaryotic YEATS domain 1.8E-08 46 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7S1|AF9_GIBZE Protein AF-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YAF9 PE=3 SV=1 1 263 2.0E-134
sp|Q7RZK7|AF9_NEUCR Protein AF-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yaf9 PE=3 SV=1 1 266 3.0E-100
sp|Q4WPM8|AF9_ASPFU Protein AF-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yaf9 PE=3 SV=2 3 271 7.0E-57
sp|Q5BC71|AF9_EMENI Protein AF-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yaf9 PE=3 SV=1 3 261 5.0E-50
sp|Q10319|AF9_SCHPO Protein AF-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yaf9 PE=3 SV=1 1 234 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7S1|AF9_GIBZE Protein AF-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YAF9 PE=3 SV=1 1 263 2.0E-134
sp|Q7RZK7|AF9_NEUCR Protein AF-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yaf9 PE=3 SV=1 1 266 3.0E-100
sp|Q4WPM8|AF9_ASPFU Protein AF-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yaf9 PE=3 SV=2 3 271 7.0E-57
sp|Q5BC71|AF9_EMENI Protein AF-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yaf9 PE=3 SV=1 3 261 5.0E-50
sp|Q10319|AF9_SCHPO Protein AF-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yaf9 PE=3 SV=1 1 234 1.0E-39
sp|P53930|AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAF9 PE=1 SV=1 1 167 6.0E-39
sp|Q6FXM4|AF9_CANGA Protein AF-9 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAF9 PE=3 SV=1 1 167 4.0E-38
sp|Q6CIV8|AF9_KLULA Protein AF-9 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAF9 PE=3 SV=1 3 167 1.0E-37
sp|Q755P0|AF9_ASHGO Protein AF-9 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YAF9 PE=3 SV=1 1 171 3.0E-37
sp|Q9FH40|TA14B_ARATH Transcription initiation factor TFIID subunit 14b OS=Arabidopsis thaliana GN=TAF14B PE=1 SV=1 1 249 2.0E-24
sp|Q59LC9|AF9_CANAL Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAF9 PE=3 SV=1 4 170 1.0E-23
sp|F4IPK2|TAF14_ARATH Transcription initiation factor TFIID subunit 14 OS=Arabidopsis thaliana GN=TAF14 PE=1 SV=1 9 266 2.0E-20
sp|Q6CF24|AF9_YARLI Protein AF-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAF9 PE=3 SV=1 62 167 7.0E-20
sp|Q4PFI5|AF9_USTMA Protein AF-9 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YAF9 PE=3 SV=1 58 127 4.0E-17
sp|P0CM08|AF9_CRYNJ Protein AF-9 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YAF9 PE=3 SV=1 10 128 9.0E-17
sp|P0CM09|AF9_CRYNB Protein AF-9 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YAF9 PE=3 SV=1 10 128 9.0E-17
sp|O95619|YETS4_HUMAN YEATS domain-containing protein 4 OS=Homo sapiens GN=YEATS4 PE=1 SV=1 8 168 3.0E-16
sp|Q9CR11|YETS4_MOUSE YEATS domain-containing protein 4 OS=Mus musculus GN=Yeats4 PE=2 SV=1 8 168 3.0E-16
sp|A2AM29|AF9_MOUSE Protein AF-9 OS=Mus musculus GN=Mllt3 PE=1 SV=1 39 171 2.0E-10
sp|Q03111|ENL_HUMAN Protein ENL OS=Homo sapiens GN=MLLT1 PE=1 SV=2 39 176 3.0E-10
sp|P42568|AF9_HUMAN Protein AF-9 OS=Homo sapiens GN=MLLT3 PE=1 SV=2 39 171 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4426
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7705 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4108
Ophiocordyceps camponoti-floridani Ophcf2|06549
Ophiocordyceps camponoti-rufipedis Ophun1|2892
Ophiocordyceps kimflemingae Ophio5|3741
Ophiocordyceps subramaniannii Hirsu2|917

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7705
MAPSNQLGRRVKLTQIRRPFVVGTTALPFSDSNPKPPGTPENHTHSWQVFVKGLEDTDITYWVRRVQFKLHESIP
NYIRMIEGQVGKPFVVNETGWGEFDIAIKLYYVNESGEKPQTLYHYLRLHPYGRTEEEKQAMVMQNGQVRAWSYE
EQLFNEPYEAFFNLLTAGAVPRGWNTAKGKGKGKGKARPPPPPLPDPESGDVWEHSAMIPNHNRPGQPFSRETEA
AEAKKLQEARLKTEELTTKLMADIKDRDLLLAKLKAENLAAFAATRPA*
Coding >OphauG2|7705
ATGGCGCCCTCGAACCAACTCGGGCGACGCGTCAAGTTGACGCAGATTCGTCGCCCGTTTGTCGTTGGCACCACA
GCCTTGCCCTTTTCCGACTCTAATCCCAAGCCCCCAGGCACACCCGAAAACCACACCCACTCGTGGCAGGTCTTT
GTCAAGGGGCTTGAGGATACTGACATCACATACTGGGTGCGACGCGTTCAATTTAAGCTACATGAGTCGATTCCC
AATTACATTCGCATGATTGAAGGCCAAGTCGGTAAACCCTTCGTCGTCAACGAAACAGGCTGGGGCGAATTCGAC
ATCGCCATTAAGCTCTACTACGTCAACGAATCTGGCGAAAAGCCCCAAACCCTATACCACTACCTCCGCCTCCAC
CCCTATGGCCGCACCGAGGAGGAAAAACAAGCCATGGTTATGCAAAACGGCCAAGTCCGCGCCTGGTCCTACGAG
GAACAGCTCTTCAACGAGCCCTACGAAGCCTTCTTCAACCTCCTCACCGCCGGCGCCGTCCCGCGCGGCTGGAAC
ACGGCCAAGGGCAAGGGCAAAGGCAAAGGCAAAGCGAGACCCCCGCCCCCGCCCCTCCCCGACCCGGAATCCGGC
GACGTTTGGGAACACTCGGCCATGATTCCAAACCACAATCGCCCCGGACAGCCCTTTAGCCGCGAGACAGAGGCC
GCCGAGGCTAAGAAACTCCAGGAAGCCCGCCTCAAGACTGAAGAGCTGACGACTAAACTCATGGCCGACATCAAG
GACCGAGACCTCTTGCTTGCAAAGCTCAAGGCCGAAAACTTGGCGGCTTTCGCTGCCACGCGTCCTGCTTAG
Transcript >OphauG2|7705
ATGGCGCCCTCGAACCAACTCGGGCGACGCGTCAAGTTGACGCAGATTCGTCGCCCGTTTGTCGTTGGCACCACA
GCCTTGCCCTTTTCCGACTCTAATCCCAAGCCCCCAGGCACACCCGAAAACCACACCCACTCGTGGCAGGTCTTT
GTCAAGGGGCTTGAGGATACTGACATCACATACTGGGTGCGACGCGTTCAATTTAAGCTACATGAGTCGATTCCC
AATTACATTCGCATGATTGAAGGCCAAGTCGGTAAACCCTTCGTCGTCAACGAAACAGGCTGGGGCGAATTCGAC
ATCGCCATTAAGCTCTACTACGTCAACGAATCTGGCGAAAAGCCCCAAACCCTATACCACTACCTCCGCCTCCAC
CCCTATGGCCGCACCGAGGAGGAAAAACAAGCCATGGTTATGCAAAACGGCCAAGTCCGCGCCTGGTCCTACGAG
GAACAGCTCTTCAACGAGCCCTACGAAGCCTTCTTCAACCTCCTCACCGCCGGCGCCGTCCCGCGCGGCTGGAAC
ACGGCCAAGGGCAAGGGCAAAGGCAAAGGCAAAGCGAGACCCCCGCCCCCGCCCCTCCCCGACCCGGAATCCGGC
GACGTTTGGGAACACTCGGCCATGATTCCAAACCACAATCGCCCCGGACAGCCCTTTAGCCGCGAGACAGAGGCC
GCCGAGGCTAAGAAACTCCAGGAAGCCCGCCTCAAGACTGAAGAGCTGACGACTAAACTCATGGCCGACATCAAG
GACCGAGACCTCTTGCTTGCAAAGCTCAAGGCCGAAAACTTGGCGGCTTTCGCTGCCACGCGTCCTGCTTAG
Gene >OphauG2|7705
ATGGCGCCCTCGAACCAACTCGGGCGACGCGTCAAGTTGACGCAGATTCGTCGCCCGTTTGTCGTTGGCACCACA
GCCTTGCCCTTTTCCGACTCTAATCCCAAGCCCCCAGGCACACCCGAAAACCACACCCACTCGTGGCAGGTCTTT
GTCAAGGGGCTTGAGGATACTGACATCACATACTGGGTGCGACGCGTTCAATTTAAGCTACATGAGTCGATTCCC
AATTACATTCGCAGTACGCCCTGGCCTTATATTTCCCCTCACTCCAAGCCTTTTTGTTTTTTGTTTTTTGTTTAT
TTATTTTTTACTAACACGAAATGTTCATAGTGATTGAAGGCCAAGTCGGTAAACCCTTCGTCGTCAACGAAACAG
GCTGGGGCGAATTCGACATCGCCATTAAGCTCTACTACGTCAACGAATCTGGCGAAAAGCCCCAAACCCTATACC
ACTACCTCCGCCTCCACCCCTATGGCCGCACCGAGGAGGAAAAACAAGCCATGGTTATGCAAAACGGCCAAGTCC
GCGCCTGGTCCTACGAGGAACAGCTCTTCAACGAGCCCTACGAAGCCTTCTTCAACCTCCTCACCGCCGGCGCCG
TCCCGCGCGGCTGGAACACGGCCAAGGGCAAGGGCAAAGGCAAAGGCAAAGCGAGACCCCCGCCCCCGCCCCTCC
CCGACCCGGAATCCGGCGACGTTTGGGAACACTCGGCCATGATTCCAAACCACAATCGCCCCGGACAGCCCTTTA
GCCGCGAGACAGAGGCCGCCGAGGCTAAGAAACTCCAGGAAGCCCGCCTCAAGACTGAAGAGCTGACGACTAAAC
TCATGGCCGACATCAAGGACCGAGACCTCTTGCTTGCAAAGCTCAAGGCCGAAAACTTGGCGGCTTTCGCTGCCA
CGCGTCCTGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail