Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7703
Gene name
LocationContig_923:174..1056
Strand+
Gene length (bp)882
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08231 SYF2 SYF2 splicing factor 4.5E-58 111 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZK5|SYF2_NEUCR Pre-mRNA-splicing factor syf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-4 PE=3 SV=1 57 293 4.0E-119
sp|Q5BC69|SYF2_EMENI Pre-mRNA-splicing factor syf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf2 PE=3 SV=1 16 293 9.0E-119
sp|Q521C0|SYF2_MAGO7 Pre-mRNA-splicing factor SYF2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF2 PE=3 SV=2 50 293 6.0E-114
sp|Q4WPM6|SYF2_ASPFU Pre-mRNA-splicing factor syf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf2 PE=3 SV=2 45 293 2.0E-112
sp|O59733|SYF2_SCHPO Pre-mRNA-splicing factor syf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syf2 PE=1 SV=1 53 293 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZK5|SYF2_NEUCR Pre-mRNA-splicing factor syf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-4 PE=3 SV=1 57 293 4.0E-119
sp|Q5BC69|SYF2_EMENI Pre-mRNA-splicing factor syf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf2 PE=3 SV=1 16 293 9.0E-119
sp|Q521C0|SYF2_MAGO7 Pre-mRNA-splicing factor SYF2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF2 PE=3 SV=2 50 293 6.0E-114
sp|Q4WPM6|SYF2_ASPFU Pre-mRNA-splicing factor syf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf2 PE=3 SV=2 45 293 2.0E-112
sp|O59733|SYF2_SCHPO Pre-mRNA-splicing factor syf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syf2 PE=1 SV=1 53 293 2.0E-42
sp|Q6CFW4|SYF2_YARLI Pre-mRNA-splicing factor SYF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SYF2 PE=3 SV=1 92 293 2.0E-26
sp|Q6DGP2|SYF2_DANRE Pre-mRNA-splicing factor syf2 OS=Danio rerio GN=syf2 PE=2 SV=1 28 293 5.0E-25
sp|Q28G05|SYF2_XENTR Pre-mRNA-splicing factor syf2 OS=Xenopus tropicalis GN=syf2 PE=2 SV=1 18 293 4.0E-24
sp|Q6DV01|SYF2_GECJA Pre-mRNA-splicing factor syf2 OS=Gecko japonicus GN=syf2 PE=2 SV=1 17 293 1.0E-23
sp|Q4QRB2|SYF2_RAT Pre-mRNA-splicing factor SYF2 OS=Rattus norvegicus GN=Syf2 PE=2 SV=1 32 293 4.0E-23
sp|Q9D198|SYF2_MOUSE Pre-mRNA-splicing factor SYF2 OS=Mus musculus GN=Syf2 PE=2 SV=1 32 293 4.0E-23
sp|Q8AVQ6|SYF2_XENLA Pre-mRNA-splicing factor syf2 OS=Xenopus laevis GN=syf2 PE=2 SV=1 35 293 2.0E-21
sp|Q6BVE0|SYF2_DEBHA Pre-mRNA-splicing factor SYF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SYF2 PE=3 SV=2 52 277 5.0E-20
sp|O95926|SYF2_HUMAN Pre-mRNA-splicing factor SYF2 OS=Homo sapiens GN=SYF2 PE=1 SV=1 53 293 2.0E-19
sp|Q9V5Q4|SYF2_DROME Pre-mRNA-splicing factor Syf2 OS=Drosophila melanogaster GN=Syf2 PE=2 SV=1 105 293 2.0E-16
sp|Q28XK6|SYF2_DROPS Pre-mRNA-splicing factor Syf2 OS=Drosophila pseudoobscura pseudoobscura GN=Syf2 PE=3 SV=1 105 293 4.0E-15
sp|Q612R3|SYF2_CAEBR Pre-mRNA-splicing factor syf-2 OS=Caenorhabditis briggsae GN=syf-2 PE=3 SV=2 105 293 3.0E-10
sp|Q09385|SYF2_CAEEL Pre-mRNA-splicing factor syf-2 OS=Caenorhabditis elegans GN=syf-2 PE=3 SV=3 51 293 8.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4434
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7703 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4110
Ophiocordyceps camponoti-floridani Ophcf2|06547
Ophiocordyceps camponoti-rufipedis Ophun1|2894
Ophiocordyceps kimflemingae Ophio5|3743
Ophiocordyceps subramaniannii Hirsu2|919

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7703
MEAPPKEQQAPAQMSAESPSTTTATNAASQQSNGAPSQQAAPKIDAAQLAKDRLARFKSLQARAKESLEENLKEA
TKEVQRLNSDTSQLPALERKHAIASQKLLKSDVEAAGGDFERERAWDWTVDECDEWDKRVKKKAAHRDGNAFRDY
QQESNKVYKRQLRNIKPDLEQYDKQKMAAVEKAAASGGLDIVETENGELIAIDKDGSFYSTADSTNFAQNKPDKA
AVDRLVQDLRRAEDQRLKKRRDRMADQGDQGDVTYINEKNKQFNQKLARFYDKYTADIRDSFERGTMI*
Coding >OphauG2|7703
ATGGAAGCTCCCCCCAAAGAGCAACAGGCACCAGCGCAAATGTCTGCCGAGTCGCCGTCAACCACAACGGCCACA
AATGCAGCATCACAGCAATCAAATGGCGCCCCGAGTCAACAAGCAGCTCCAAAAATCGACGCCGCTCAACTAGCC
AAGGATCGCTTAGCCCGTTTCAAGTCATTGCAAGCCAGAGCAAAGGAGTCGTTGGAAGAAAATCTCAAGGAAGCC
ACAAAGGAAGTCCAGCGCCTCAACAGCGATACAAGCCAGCTCCCGGCTTTGGAACGTAAACACGCCATTGCTTCC
CAAAAATTGCTCAAGTCAGACGTTGAGGCTGCTGGAGGAGACTTTGAGCGCGAAAGAGCGTGGGACTGGACTGTG
GACGAGTGCGATGAGTGGGATAAGCGCGTCAAGAAGAAGGCGGCGCACCGCGATGGAAATGCATTCCGCGACTAT
CAGCAGGAGAGTAACAAGGTATACAAGCGGCAGTTGCGCAACATCAAACCCGACTTGGAACAATACGACAAGCAA
AAGATGGCAGCTGTGGAAAAGGCGGCGGCTTCGGGCGGACTCGACATTGTGGAAACGGAGAATGGCGAGCTCATT
GCCATTGACAAGGACGGCTCTTTCTACTCGACGGCAGACTCGACAAACTTTGCGCAAAACAAGCCAGACAAGGCC
GCTGTGGACCGATTGGTGCAAGATTTGCGCCGCGCCGAGGATCAGCGGCTGAAGAAGAGGAGGGATCGCATGGCT
GACCAGGGCGACCAGGGCGACGTGACATATATTAATGAGAAGAACAAGCAGTTCAACCAGAAGCTGGCCCGTTTT
TACGACAAGTACACGGCCGATATTCGCGACAGTTTCGAGAGAGGCACCATGATATGA
Transcript >OphauG2|7703
ATGGAAGCTCCCCCCAAAGAGCAACAGGCACCAGCGCAAATGTCTGCCGAGTCGCCGTCAACCACAACGGCCACA
AATGCAGCATCACAGCAATCAAATGGCGCCCCGAGTCAACAAGCAGCTCCAAAAATCGACGCCGCTCAACTAGCC
AAGGATCGCTTAGCCCGTTTCAAGTCATTGCAAGCCAGAGCAAAGGAGTCGTTGGAAGAAAATCTCAAGGAAGCC
ACAAAGGAAGTCCAGCGCCTCAACAGCGATACAAGCCAGCTCCCGGCTTTGGAACGTAAACACGCCATTGCTTCC
CAAAAATTGCTCAAGTCAGACGTTGAGGCTGCTGGAGGAGACTTTGAGCGCGAAAGAGCGTGGGACTGGACTGTG
GACGAGTGCGATGAGTGGGATAAGCGCGTCAAGAAGAAGGCGGCGCACCGCGATGGAAATGCATTCCGCGACTAT
CAGCAGGAGAGTAACAAGGTATACAAGCGGCAGTTGCGCAACATCAAACCCGACTTGGAACAATACGACAAGCAA
AAGATGGCAGCTGTGGAAAAGGCGGCGGCTTCGGGCGGACTCGACATTGTGGAAACGGAGAATGGCGAGCTCATT
GCCATTGACAAGGACGGCTCTTTCTACTCGACGGCAGACTCGACAAACTTTGCGCAAAACAAGCCAGACAAGGCC
GCTGTGGACCGATTGGTGCAAGATTTGCGCCGCGCCGAGGATCAGCGGCTGAAGAAGAGGAGGGATCGCATGGCT
GACCAGGGCGACCAGGGCGACGTGACATATATTAATGAGAAGAACAAGCAGTTCAACCAGAAGCTGGCCCGTTTT
TACGACAAGTACACGGCCGATATTCGCGACAGTTTCGAGAGAGGCACCATGATATGA
Gene >OphauG2|7703
ATGGAAGCTCCCCCCAAAGAGCAACAGGCACCAGCGCAAATGTCTGCCGAGTCGCCGTCAACCACAACGGCCACA
AATGCAGCATCACAGCAATCAAATGGCGCCCCGAGTCAACAAGCAGCTCCAAAAATCGACGCCGCTCAACTAGCC
AAGGATCGCTTAGCCCGTTTCAAGTCATTGCAAGCCAGAGCAAAGGAGTCGTTGGAAGAAAATCTCAAGGAAGCC
ACAAAGGAAGTCCAGCGCCTCAACAGCGATACAAGCCAGCTCCCGGCTTTGGAACGTAAACACGCCATTGCTTCC
CAAAAATTGCTCAAGTCAGACGTTGAGGCTGCTGGAGGAGACTTTGAGCGCGAAAGAGCGTGGGACTGGACTGTG
GACGAGTGCGATGAGTGGGATAAGCGCGTCAAGAAGAAGGCGGCGCACCGCGATGGAAATGCATTCCGCGACTAT
CAGCAGGAGAGTAACAAGGTATACAAGCGGCAGTTGCGCAACATCAAACCCGACTTGGAACAATACGACAAGCAA
AAGATGGCAGCTGTGGAAAAGGCGGCGGCTTCGGGCGGACTCGACATTGTGGAAACGGAGAATGGCGAGCTCATT
GCCATTGACAAGGACGGCTCTTTCTACTCGACGGCAGACTCGACAAACTTTGCGCAAAACAAGCCAGACAAGGCC
GCTGTGGACCGATTGGTGCAAGATTTGCGCCGCGCCGAGGATCAGCGGCTGAAGAAGAGGAGGGATCGCATGGCT
GACCAGGGCGACCAGGGCGACGTGACATATATTAATGAGAAGAACAAGCAGTTCAACCAGAAGCTGGCCCGTTTT
TACGACAAGTACACGGCCGATATTCGCGACAGTTTCGAGAGAGGCACCATGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail