Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7700
Gene name
LocationContig_921:4048..6150
Strand+
Gene length (bp)2102
Transcript length (bp)1812
Coding sequence length (bp)1812
Protein length (aa) 604

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11001 DUF2841 Protein of unknown function (DUF2841) 6.9E-42 207 352

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04608|YD124_YEAST Uncharacterized protein YDR124W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR124W PE=1 SV=1 222 368 3.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2369
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7700 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|585
Ophiocordyceps camponoti-floridani Ophcf2|03642
Ophiocordyceps camponoti-rufipedis Ophun1|1309
Ophiocordyceps kimflemingae Ophio5|7855
Ophiocordyceps subramaniannii Hirsu2|3308

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7700
MVRDWPHPRQQSFQQQCYPPVTRHPSFQHDRYGPDTATRQDSFQQDRYPIESSDNTRFHDPYDMHRRQPPMQIDE
ALRSYCGIAGKHYFVATISEEGMPLTFFSPGHKLHENTIHQFFDENKFQQVIRRMETGAVDPMRDDGLGYDDSRF
SRQGGYGRTRTTERRRSSALDDWGSPARPGRKRPRARHALNEEEEVPIMMSARRGIKIGDSEAVWKFYEQRFKNC
QQTACKLIAKAWVKVVEPKKQSTHPYTGSDEKAPDWWPKPWGPTKEEKVRHKEPDHLYKRERVHLLAHILRLVVE
PQPKQHQDIQKLGLTVTKLEESTMEALSAFFMDAEGNNKKRAYLCEIFKMAKQEERYKNGEIDDSTEVYVMAEDK
MPDNYGSENDDVTLIKTEDQPEVHRAKPQVTHCLGPTSTSAPATAHGLHSGSSGSFMGELPVRGTSFHAPPLLQT
ELGSQQHPFVESTMPVGDQAAVSAGGGGLGLDLVASPHESSRRPSVFSEYTSPGGGSLYTQPWQQASTGSNAPSI
YAYTPQPASAQQSAFVSQTVHMNPTPPFMTGSFESSPRAEYEANHGAIFRAGEMPQGSVSHQQGYYVSNDSRGGL
RAS*
Coding >OphauG2|7700
ATGGTTCGAGACTGGCCGCATCCACGGCAGCAGTCGTTCCAGCAGCAATGCTACCCTCCAGTAACTCGCCACCCG
TCGTTCCAACATGATCGATATGGCCCCGACACGGCAACTCGACAGGATTCATTTCAACAGGATCGTTACCCAATC
GAGAGCAGCGACAACACGCGCTTCCACGATCCATATGACATGCATCGTCGACAGCCACCCATGCAAATTGATGAG
GCGCTGAGATCATACTGTGGTATTGCAGGAAAGCACTACTTTGTCGCCACAATCAGCGAGGAGGGAATGCCCTTG
ACCTTTTTTAGTCCTGGCCACAAGCTGCATGAAAATACCATTCACCAGTTTTTCGACGAAAACAAGTTTCAGCAG
GTGATTCGCAGGATGGAAACGGGCGCCGTGGACCCTATGCGCGACGACGGACTGGGCTACGACGACTCGAGGTTT
TCTCGGCAGGGTGGCTATGGTAGGACGCGCACGACGGAACGAAGACGCAGCTCGGCTCTCGACGACTGGGGAAGC
CCTGCGCGGCCAGGTCGCAAGAGGCCCAGGGCACGCCATGCGCTCAATGAAGAGGAAGAAGTTCCCATCATGATG
TCTGCGCGCCGGGGCATCAAGATTGGCGATTCGGAGGCTGTGTGGAAGTTTTACGAGCAACGTTTCAAGAACTGC
CAGCAAACCGCCTGCAAGCTGATTGCCAAGGCATGGGTCAAGGTGGTTGAGCCCAAGAAGCAGTCGACACATCCC
TATACAGGAAGCGACGAAAAGGCGCCCGACTGGTGGCCCAAGCCGTGGGGCCCGACAAAGGAGGAAAAGGTTCGG
CACAAGGAGCCGGACCATTTGTATAAGCGAGAACGTGTTCATTTACTGGCTCATATCCTGAGGCTTGTAGTGGAA
CCGCAACCCAAACAGCATCAGGATATTCAAAAATTAGGTCTAACTGTGACAAAGCTGGAAGAGTCGACAATGGAG
GCTCTATCGGCCTTTTTCATGGATGCCGAAGGAAACAATAAAAAGAGGGCGTATTTGTGCGAAATTTTCAAGATG
GCTAAGCAAGAAGAACGATACAAGAATGGCGAAATTGACGATTCTACCGAGGTGTACGTCATGGCTGAAGATAAA
ATGCCGGACAATTACGGGTCCGAGAATGACGACGTGACATTAATCAAGACGGAAGATCAACCAGAGGTGCATCGG
GCCAAGCCGCAAGTGACGCACTGCCTGGGCCCGACGTCGACGTCTGCTCCAGCCACTGCGCACGGCCTTCACTCT
GGATCGAGTGGCTCCTTTATGGGCGAGTTGCCGGTTCGAGGCACAAGCTTCCATGCGCCTCCGCTGCTCCAAACA
GAGCTTGGGTCGCAGCAGCATCCGTTTGTGGAGAGTACAATGCCTGTGGGCGATCAGGCTGCAGTGAGCGCCGGG
GGCGGCGGTCTAGGCCTCGACCTAGTGGCCAGCCCACACGAATCGAGCAGACGACCGTCGGTTTTCAGCGAGTAC
ACGAGTCCTGGAGGCGGCAGCCTGTACACGCAGCCGTGGCAACAGGCTTCTACTGGCTCCAACGCACCATCAATC
TATGCTTACACTCCCCAGCCAGCAAGCGCCCAGCAGTCAGCCTTTGTCTCCCAGACGGTCCATATGAATCCCACA
CCGCCCTTTATGACTGGCTCGTTTGAGAGTTCACCACGCGCGGAATACGAGGCAAACCACGGCGCTATATTCCGC
GCTGGCGAAATGCCACAGGGTTCCGTCAGCCACCAGCAGGGATACTACGTGTCCAATGATAGCCGAGGGGGGCTA
CGTGCCTCTTGA
Transcript >OphauG2|7700
ATGGTTCGAGACTGGCCGCATCCACGGCAGCAGTCGTTCCAGCAGCAATGCTACCCTCCAGTAACTCGCCACCCG
TCGTTCCAACATGATCGATATGGCCCCGACACGGCAACTCGACAGGATTCATTTCAACAGGATCGTTACCCAATC
GAGAGCAGCGACAACACGCGCTTCCACGATCCATATGACATGCATCGTCGACAGCCACCCATGCAAATTGATGAG
GCGCTGAGATCATACTGTGGTATTGCAGGAAAGCACTACTTTGTCGCCACAATCAGCGAGGAGGGAATGCCCTTG
ACCTTTTTTAGTCCTGGCCACAAGCTGCATGAAAATACCATTCACCAGTTTTTCGACGAAAACAAGTTTCAGCAG
GTGATTCGCAGGATGGAAACGGGCGCCGTGGACCCTATGCGCGACGACGGACTGGGCTACGACGACTCGAGGTTT
TCTCGGCAGGGTGGCTATGGTAGGACGCGCACGACGGAACGAAGACGCAGCTCGGCTCTCGACGACTGGGGAAGC
CCTGCGCGGCCAGGTCGCAAGAGGCCCAGGGCACGCCATGCGCTCAATGAAGAGGAAGAAGTTCCCATCATGATG
TCTGCGCGCCGGGGCATCAAGATTGGCGATTCGGAGGCTGTGTGGAAGTTTTACGAGCAACGTTTCAAGAACTGC
CAGCAAACCGCCTGCAAGCTGATTGCCAAGGCATGGGTCAAGGTGGTTGAGCCCAAGAAGCAGTCGACACATCCC
TATACAGGAAGCGACGAAAAGGCGCCCGACTGGTGGCCCAAGCCGTGGGGCCCGACAAAGGAGGAAAAGGTTCGG
CACAAGGAGCCGGACCATTTGTATAAGCGAGAACGTGTTCATTTACTGGCTCATATCCTGAGGCTTGTAGTGGAA
CCGCAACCCAAACAGCATCAGGATATTCAAAAATTAGGTCTAACTGTGACAAAGCTGGAAGAGTCGACAATGGAG
GCTCTATCGGCCTTTTTCATGGATGCCGAAGGAAACAATAAAAAGAGGGCGTATTTGTGCGAAATTTTCAAGATG
GCTAAGCAAGAAGAACGATACAAGAATGGCGAAATTGACGATTCTACCGAGGTGTACGTCATGGCTGAAGATAAA
ATGCCGGACAATTACGGGTCCGAGAATGACGACGTGACATTAATCAAGACGGAAGATCAACCAGAGGTGCATCGG
GCCAAGCCGCAAGTGACGCACTGCCTGGGCCCGACGTCGACGTCTGCTCCAGCCACTGCGCACGGCCTTCACTCT
GGATCGAGTGGCTCCTTTATGGGCGAGTTGCCGGTTCGAGGCACAAGCTTCCATGCGCCTCCGCTGCTCCAAACA
GAGCTTGGGTCGCAGCAGCATCCGTTTGTGGAGAGTACAATGCCTGTGGGCGATCAGGCTGCAGTGAGCGCCGGG
GGCGGCGGTCTAGGCCTCGACCTAGTGGCCAGCCCACACGAATCGAGCAGACGACCGTCGGTTTTCAGCGAGTAC
ACGAGTCCTGGAGGCGGCAGCCTGTACACGCAGCCGTGGCAACAGGCTTCTACTGGCTCCAACGCACCATCAATC
TATGCTTACACTCCCCAGCCAGCAAGCGCCCAGCAGTCAGCCTTTGTCTCCCAGACGGTCCATATGAATCCCACA
CCGCCCTTTATGACTGGCTCGTTTGAGAGTTCACCACGCGCGGAATACGAGGCAAACCACGGCGCTATATTCCGC
GCTGGCGAAATGCCACAGGGTTCCGTCAGCCACCAGCAGGGATACTACGTGTCCAATGATAGCCGAGGGGGGCTA
CGTGCCTCTTGA
Gene >OphauG2|7700
ATGGTTCGAGACTGGCCGCATCCACGGCAGCAGTCGTTCCAGCAGCAATGCTACCCTCCAGTAACTCGCCACCCG
TCGTTCCAACATGATCGATATGGCCCCGACACGGCAACTCGACAGGATTCATTTCAACAGGATCGTTACCCAATC
GAGAGCAGCGACAACACGCGCTTCCACGATCCATATGACATGCATCGTCGACAGCCACCCATGGTGAGTAATGGT
AGTCTTGTCGTCTTGGGCGAGTCACTGGCTGACTGGGACGAAAACTATGACTTTGGGCCATGACAGCAAATTGAT
GAGGCGCTGAGATCATACTGTGGTATTGCAGGAAAGCACTACTTTGTCGCCACAATCAGCGAGGAGGGAATGCCC
TTGACCTTTTTTAGTCCTGGCCACAAGCTGCATGAAAATACCATTCACCAGTTTTTCGACGAAAACAAGTTTCAG
CAGGTGATTCGCAGGATGGAAACGGGTCCGTCGTCTTTGAAAAGTCTGCTGGTTTTTGCCTCGTCTTGACTCTGA
CCCATTTTGCAGGCGCCGTGGACCCTATGCGCGACGACGGACTGGGCTACGACGACTCGAGGTTTTCTCGGCAGG
GTGGCTATGGTAGGACGCGCACGACGGAACGAAGACGCAGCTCGGCTCTCGACGACTGGGGAAGCCCTGCGCGGC
CAGGTCGCAAGAGGCCCAGGGCACGCCATGCGCTCAATGAAGAGGAAGAAGTTCCCATCATGATGTCTGCGCGCC
GGGGCATCAAGATTGGCGATTCGGAGGCTGTGTGGAAGTTTTACGAGCAACGTTTCAAGAACTGCCAGCAAACCG
CCTGCAAGCTGATTGCCAAGGCATGGGTCAAGGTGGTTGAGCCCAAGAAGCAGTCGACACATCCCTATACAGGAA
GCGACGAAAAGGCGCCCGACTGGTGGCCCAAGCCGTGGGGCCCGACAAAGGAGGAAAAGGTTCGGCACAAGGAGC
CGGACCATTTGTATAAGCGAGGTGAGAGGCGCCCTTGCGCTTGACTCTGCCACTGTGGCCTGTGTGCTGACGCGT
GTGCATGATGAAATTGCCCCATGACAGAACGTGTTCATTTACTGGCTCATATCCTGAGGCTTGTAGTGGAACCGC
AACCCAAACAGCATCAGGATATTCAAAAATTAGGTCTAACTGTGACAAAGCTGGAAGAGTCGACAATGGAGGCTC
TATCGGCCTTTTTCATGGATGCCGAAGGAAACAATAAAAAGAGGGCGTATTTGTGCGAAATTTTCAAGATGGCTA
AGCAAGAAGAACGATACAAGAATGGCGAAATTGGTAAGGCCTCTATGCCCCATGGCTTGAGTTTGGCATGGTTTT
GCAAAAAGTGCTGACTAGAAGCTCTAGACGATTCTACCGAGGTGTACGTCATGGCTGAAGATAAAATGCCGGACA
ATTACGGGTCCGAGAATGACGACGTGACATTAATCAAGACGGAAGATCAACCAGAGGTGCATCGGGCCAAGCCGC
AAGTGACGCACTGCCTGGGCCCGACGTCGACGTCTGCTCCAGCCACTGCGCACGGCCTTCACTCTGGATCGAGTG
GCTCCTTTATGGGCGAGTTGCCGGTTCGAGGCACAAGCTTCCATGCGCCTCCGCTGCTCCAAACAGAGCTTGGGT
CGCAGCAGCATCCGTTTGTGGAGAGTACAATGCCTGTGGGCGATCAGGCTGCAGTGAGCGCCGGGGGCGGCGGTC
TAGGCCTCGACCTAGTGGCCAGCCCACACGAATCGAGCAGACGACCGTCGGTTTTCAGCGAGTACACGAGTCCTG
GAGGCGGCAGCCTGTACACGCAGCCGTGGCAACAGGCTTCTACTGGCTCCAACGCACCATCAATCTATGCTTACA
CTCCCCAGCCAGCAAGCGCCCAGCAGTCAGCCTTTGTCTCCCAGACGGTCCATATGAATCCCACACCGCCCTTTA
TGACTGGCTCGTTTGAGAGTTCACCACGCGCGGAATACGAGGCAAACCACGGCGCTATATTCCGCGCTGGCGAAA
TGCCACAGGGTTCCGTCAGCCACCAGCAGGGATACTACGTGTCCAATGATAGCCGAGGGGGGCTACGTGCCTCTT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail