Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7676
Gene name
LocationContig_919:2531..4007
Strand-
Gene length (bp)1476
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07942 CARME Carnosine N-methyltransferase 1.6E-58 175 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q80UY1|CARME_MOUSE Carnosine N-methyltransferase OS=Mus musculus GN=Carnmt1 PE=1 SV=1 81 436 3.0E-40
sp|Q9Y7J3|CARME_SCHPO Carnosine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 83 435 5.0E-40
sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens GN=CARNMT1 PE=1 SV=1 88 436 4.0E-39
sp|Q5BJZ6|CARME_RAT Carnosine N-methyltransferase OS=Rattus norvegicus GN=Carnmt1 PE=1 SV=1 81 436 8.0E-39
sp|F1N9S8|CARME_CHICK Carnosine N-methyltransferase OS=Gallus gallus GN=CARNMT1 PE=1 SV=2 88 436 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q80UY1|CARME_MOUSE Carnosine N-methyltransferase OS=Mus musculus GN=Carnmt1 PE=1 SV=1 81 436 3.0E-40
sp|Q9Y7J3|CARME_SCHPO Carnosine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 83 435 5.0E-40
sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens GN=CARNMT1 PE=1 SV=1 88 436 4.0E-39
sp|Q5BJZ6|CARME_RAT Carnosine N-methyltransferase OS=Rattus norvegicus GN=Carnmt1 PE=1 SV=1 81 436 8.0E-39
sp|F1N9S8|CARME_CHICK Carnosine N-methyltransferase OS=Gallus gallus GN=CARNMT1 PE=1 SV=2 88 436 2.0E-37
sp|Q9I7X6|CARME_DROME Carnosine N-methyltransferase OS=Drosophila melanogaster GN=CG11596 PE=1 SV=1 176 436 2.0E-29
sp|Q54ST2|CARME_DICDI Carnosine N-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0282239 PE=3 SV=1 126 434 9.0E-26
sp|P53934|CARME_YEAST Carnosine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL092W PE=1 SV=1 91 367 2.0E-22
sp|Q03648|YM59_YEAST Uncharacterized protein YMR209C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR209C PE=1 SV=1 94 388 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7676
MIKVLIRRLVAWCWLSRLLPAWSGAQNGSAVAGGYIEVHQVVVTLQQSQSQADSSRHLEQEARLLASLDRSKGAW
TESHGRHRLLSALHGFTRYEERQRAELGRLRRLLKGVSKAQRAFLDHHVAYWAKFDRVQDALAANQQLCNDIVAS
ALDYYRVDSSELRAFIHDAEARGHVADKTAVSQALKHIVRDWTSHGHAERSLPFACMLDTADNLFPARLAASEPV
RVLLPGAGLARLGHQLDRLGGFQVTVNEWSMFVNVVYRFLDKHGLYPNHHSLHPFVDAWSHHATDADMLRKLSFP
DHALNPRSVLLVEGDFTTVFAHQDAHYHLLLTYFFIDTARNLMAYLDTIKKLLKPGGYWLNLGPLLYGTAPMVQL
SLEDIITVTKAMGFDFVPTDDKCGPLTFQDSTVRSVEANYGFDNKALTKHSYNAQFWVAKKL*
Coding >OphauG2|7676
ATGATCAAGGTGCTGATTCGTCGCCTGGTTGCGTGGTGCTGGCTCAGCCGTCTTTTGCCTGCATGGTCAGGGGCC
CAGAATGGCAGCGCGGTGGCGGGCGGATACATCGAGGTGCACCAGGTGGTGGTGACACTGCAACAGAGCCAGAGC
CAGGCAGACAGCAGCAGACACCTTGAACAGGAGGCGCGGCTGTTGGCGTCGCTCGACAGAAGCAAGGGCGCGTGG
ACAGAGAGCCATGGGCGGCACCGGCTGCTGAGTGCGCTGCACGGCTTCACGCGCTACGAGGAGCGGCAGAGGGCA
GAGCTGGGCCGCCTGCGCAGGCTGCTCAAGGGCGTGAGCAAGGCGCAACGAGCTTTTCTCGACCATCACGTGGCC
TATTGGGCCAAGTTTGACCGCGTCCAAGACGCGCTGGCGGCCAACCAGCAGCTGTGCAACGACATTGTCGCCTCG
GCCCTCGACTACTACCGCGTCGACAGCAGCGAGCTGCGCGCCTTTATCCACGACGCCGAGGCCCGCGGCCATGTC
GCCGACAAGACGGCCGTGTCGCAGGCCCTCAAGCACATTGTCAGGGACTGGACAAGCCACGGCCACGCCGAGCGC
AGCTTGCCCTTTGCCTGCATGCTCGACACCGCCGACAACCTGTTTCCCGCCCGGCTGGCTGCTTCTGAGCCCGTC
CGCGTCTTGCTGCCGGGAGCTGGGCTGGCCAGGCTGGGCCACCAGCTTGACCGTCTGGGTGGCTTCCAGGTCACC
GTCAACGAGTGGTCCATGTTCGTCAACGTCGTCTACCGCTTCCTCGACAAGCACGGCCTCTACCCCAACCATCAC
TCCCTCCACCCCTTTGTCGACGCCTGGTCCCACCATGCCACCGACGCAGACATGCTTCGCAAGCTCTCCTTTCCC
GACCACGCCCTTAACCCCCGCTCCGTCCTGCTCGTCGAGGGCGACTTCACCACCGTCTTTGCCCATCAAGACGCC
CACTATCACCTGCTGCTCACCTACTTCTTCATCGACACCGCCCGCAACCTCATGGCCTACCTGGACACCATCAAG
AAGCTGCTCAAGCCCGGCGGCTACTGGCTGAATCTCGGGCCTCTGCTCTACGGCACCGCCCCCATGGTCCAGCTC
TCCCTCGAGGACATCATCACCGTTACCAAAGCCATGGGCTTTGACTTTGTCCCCACCGACGACAAGTGCGGGCCC
CTCACCTTTCAAGACTCCACCGTCAGGAGCGTCGAGGCCAATTACGGCTTTGACAACAAGGCCTTGACCAAGCAT
TCATACAACGCTCAGTTTTGGGTAGCCAAGAAATTATGA
Transcript >OphauG2|7676
ATGATCAAGGTGCTGATTCGTCGCCTGGTTGCGTGGTGCTGGCTCAGCCGTCTTTTGCCTGCATGGTCAGGGGCC
CAGAATGGCAGCGCGGTGGCGGGCGGATACATCGAGGTGCACCAGGTGGTGGTGACACTGCAACAGAGCCAGAGC
CAGGCAGACAGCAGCAGACACCTTGAACAGGAGGCGCGGCTGTTGGCGTCGCTCGACAGAAGCAAGGGCGCGTGG
ACAGAGAGCCATGGGCGGCACCGGCTGCTGAGTGCGCTGCACGGCTTCACGCGCTACGAGGAGCGGCAGAGGGCA
GAGCTGGGCCGCCTGCGCAGGCTGCTCAAGGGCGTGAGCAAGGCGCAACGAGCTTTTCTCGACCATCACGTGGCC
TATTGGGCCAAGTTTGACCGCGTCCAAGACGCGCTGGCGGCCAACCAGCAGCTGTGCAACGACATTGTCGCCTCG
GCCCTCGACTACTACCGCGTCGACAGCAGCGAGCTGCGCGCCTTTATCCACGACGCCGAGGCCCGCGGCCATGTC
GCCGACAAGACGGCCGTGTCGCAGGCCCTCAAGCACATTGTCAGGGACTGGACAAGCCACGGCCACGCCGAGCGC
AGCTTGCCCTTTGCCTGCATGCTCGACACCGCCGACAACCTGTTTCCCGCCCGGCTGGCTGCTTCTGAGCCCGTC
CGCGTCTTGCTGCCGGGAGCTGGGCTGGCCAGGCTGGGCCACCAGCTTGACCGTCTGGGTGGCTTCCAGGTCACC
GTCAACGAGTGGTCCATGTTCGTCAACGTCGTCTACCGCTTCCTCGACAAGCACGGCCTCTACCCCAACCATCAC
TCCCTCCACCCCTTTGTCGACGCCTGGTCCCACCATGCCACCGACGCAGACATGCTTCGCAAGCTCTCCTTTCCC
GACCACGCCCTTAACCCCCGCTCCGTCCTGCTCGTCGAGGGCGACTTCACCACCGTCTTTGCCCATCAAGACGCC
CACTATCACCTGCTGCTCACCTACTTCTTCATCGACACCGCCCGCAACCTCATGGCCTACCTGGACACCATCAAG
AAGCTGCTCAAGCCCGGCGGCTACTGGCTGAATCTCGGGCCTCTGCTCTACGGCACCGCCCCCATGGTCCAGCTC
TCCCTCGAGGACATCATCACCGTTACCAAAGCCATGGGCTTTGACTTTGTCCCCACCGACGACAAGTGCGGGCCC
CTCACCTTTCAAGACTCCACCGTCAGGAGCGTCGAGGCCAATTACGGCTTTGACAACAAGGCCTTGACCAAGCAT
TCATACAACGCTCAGTTTTGGGTAGCCAAGAAATTATGA
Gene >OphauG2|7676
ATGATCAAGGTGCTGATTCGTCGCCTGGTTGCGTGGTGCTGGCTCAGCCGTCTTTTGCCTGCATGGTCAGGGGCC
CAGAATGGCAGCGCGGTGGCGGGCGGATACATCGAGGTGCACCAGGTGGTGGTGACACTGCAACAGAGCCAGAGC
CAGGCAGACAGCAGCAGACACCTTGAACAGGAGGCGCGGCTGTTGGCGTCGCTCGACAGAAGCAAGGGCGCGTGG
ACAGAGAGCCATGGGCGGCACCGGCTGCTGAGTGCGCTGCACGGCTTCACGCGCTACGAGGAGCGGCAGAGGGCA
GAGCTGGGCCGCCTGCGCAGGCTGCTCAAGGGCGTGAGCAAGGCGCAACGAGCTGTAGGACAGAGAGCAGGCGAC
GATGCGCATTGGCGGCCGGCTGACGTTTGCTCGTTGCGCAGTTTCTCGACCATCACGTGGCCTATTGGGCCAAGT
TTGACCGCGTCCAAGACGCGCTGGCGGCCAACCAGCAGCTGTGCAACGACATTGTCGCCTCGGCCCTCGACTACT
ACCGCGTCGACAGCAGCGAGCTGCGCGCCTTTATCCACGACGCCGAGGCCCGCGGCCATGTCGCCGACAAGACGG
CCGTGTCGCAGGCCCTCAAGCACATTGTCAGGGACTGGACAAGCCACGGCCACGCCGAGCGCAGCTTGCCCTTTG
CCTGCATGCTCGACACCGCCGACAACCTGTTTCCCGCCCGGCTGGCTGCTTCTGAGCCCGTCCGCGTCTTGCTGC
CGGGAGCTGGGCTGGCCAGGCTGGGCCACCAGCTTGACCGTCTGGGTGGTATGTACAATGCATGCACCCCCCTAG
AAGCCCTCTCTACAAAGCGCCCTCTACAAAGCCCCCTCTACACATCCCCAGACTGACACAAGCACCCCCCCAGGC
TTCCAGGTCACCGTCAACGAGTGGTCCATGTTCGTCAACGTCGTCTACCGCTTCCTCGACAAGCACGGCCTCTAC
CCCAACCATCACTCCCTCCACCCCTTTGTCGACGCCTGGTCCCACCATGCCACCGACGCAGACATGCTTCGCAAG
CTCTCCTTTCCCGACCACGCCCTTAACCCCCGCTCCGTCCTGCTCGTCGAGGGCGACTTCACCACCGTCTTTGCC
CATCAAGACGCCCACTATCACCTGCTGCTCACCTACTTCTTCATCGACACCGCCCGCAACCTCATGGCCTACCTG
GACACCATCAAGAAGCTGCTCAAGCCCGGCGGCTACTGGCTGAATCTCGGGCCTCTGCTCTACGGCACCGCCCCC
ATGGTCCAGCTCTCCCTCGAGGACATCATCACCGTTACCAAAGCCATGGGCTTTGACTTTGTCCCCACCGACGAC
AAGTGCGGGCCCCTCACCTTTCAAGACTCCACCGTCAGGAGCGTCGAGGCCAATTACGGCTTTGACAACAAGGCC
TTGACCAAGCATTCATACAACGCTCAGTTTTGGGTAGCCAAGAAATTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail