Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|766
Gene name
LocationContig_12:27806..28425
Strand-
Gene length (bp)619
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04749 PLAC8 PLAC8 family 5.8E-22 15 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 1 120 6.0E-12
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 12 120 7.0E-12
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 1 120 9.0E-12
sp|D9HP26|CNR10_MAIZE Cell number regulator 10 OS=Zea mays GN=CNR10 PE=2 SV=1 12 120 5.0E-10
sp|Q9LS43|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana GN=PCR7 PE=2 SV=1 12 120 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 1 120 6.0E-12
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 12 120 7.0E-12
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 1 120 9.0E-12
sp|D9HP26|CNR10_MAIZE Cell number regulator 10 OS=Zea mays GN=CNR10 PE=2 SV=1 12 120 5.0E-10
sp|Q9LS43|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana GN=PCR7 PE=2 SV=1 12 120 6.0E-10
sp|D9HP27|CNR11_MAIZE Cell number regulator 11 OS=Zea mays GN=CNR11 PE=2 SV=1 14 132 2.0E-08
sp|Q6MW50|YB290_NEUCR Uncharacterized protein NCU10291 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B4B2.090 PE=4 SV=1 14 154 4.0E-08
sp|D9HP19|CNR3_MAIZE Cell number regulator 3 OS=Zea mays GN=CNR3 PE=2 SV=1 11 120 4.0E-07
sp|B6SJQ0|CNR13_MAIZE Cell number regulator 13 OS=Zea mays GN=CNR13 PE=2 SV=1 14 132 2.0E-06
sp|Q9M815|PCR8_ARATH Protein PLANT CADMIUM RESISTANCE 8 OS=Arabidopsis thaliana GN=PCR8 PE=1 SV=2 15 120 2.0E-06
sp|D9HP25|CNR9_MAIZE Cell number regulator 9 OS=Zea mays GN=CNR9 PE=2 SV=1 14 120 3.0E-06
sp|Q9LS44|PCR4_ARATH Protein PLANT CADMIUM RESISTANCE 4 OS=Arabidopsis thaliana GN=PCR4 PE=3 SV=1 7 120 5.0E-06
sp|B4FF80|CNR5_MAIZE Cell number regulator 5 OS=Zea mays GN=CNR5 PE=2 SV=1 2 130 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|766
MENQNTVARDDQQEWQASLFDCSPCSSCMLATCLPCMLYGRTASRKRDPTLQSEDMCNTDCALFTAVQCFTGCGW
LFSFFKRTEIRQQYGIKGSAWGDCCATYWCHCCSLIQQDNEVRLRQAAAAANAADGPITKAYESQQQGMYMPPSL
PVNEAPEKQNPTVL*
Coding >OphauG2|766
ATGGAAAACCAAAACACCGTCGCCCGCGACGACCAGCAAGAATGGCAGGCCAGTCTCTTTGACTGCTCGCCATGC
AGCTCGTGCATGCTCGCCACCTGTCTCCCATGCATGCTCTATGGCCGTACTGCGAGTCGCAAGCGTGATCCAACG
CTTCAGTCTGAAGACATGTGCAACACAGACTGCGCCTTGTTTACTGCCGTGCAATGCTTCACCGGCTGTGGCTGG
CTCTTCTCCTTTTTCAAACGTACCGAGATTCGCCAGCAGTATGGCATCAAGGGCAGCGCATGGGGCGACTGCTGT
GCCACGTACTGGTGCCACTGCTGCTCTCTCATCCAGCAAGACAATGAAGTCAGGCTCAGACAGGCCGCCGCCGCC
GCCAATGCTGCAGATGGCCCCATCACAAAGGCCTACGAGAGCCAGCAGCAGGGCATGTACATGCCTCCGTCTTTG
CCCGTCAACGAGGCCCCCGAGAAACAGAATCCAACGGTTCTGTGA
Transcript >OphauG2|766
ATGGAAAACCAAAACACCGTCGCCCGCGACGACCAGCAAGAATGGCAGGCCAGTCTCTTTGACTGCTCGCCATGC
AGCTCGTGCATGCTCGCCACCTGTCTCCCATGCATGCTCTATGGCCGTACTGCGAGTCGCAAGCGTGATCCAACG
CTTCAGTCTGAAGACATGTGCAACACAGACTGCGCCTTGTTTACTGCCGTGCAATGCTTCACCGGCTGTGGCTGG
CTCTTCTCCTTTTTCAAACGTACCGAGATTCGCCAGCAGTATGGCATCAAGGGCAGCGCATGGGGCGACTGCTGT
GCCACGTACTGGTGCCACTGCTGCTCTCTCATCCAGCAAGACAATGAAGTCAGGCTCAGACAGGCCGCCGCCGCC
GCCAATGCTGCAGATGGCCCCATCACAAAGGCCTACGAGAGCCAGCAGCAGGGCATGTACATGCCTCCGTCTTTG
CCCGTCAACGAGGCCCCCGAGAAACAGAATCCAACGGTTCTGTGA
Gene >OphauG2|766
ATGGAAAACCAAAACACCGTCGCCCGCGACGACCAGCAAGAATGGCAGGCCAGTCTCTTTGACTGCTCGCCATGC
AGCTCGTGCATGCTCGCCACCTGTCTCCCATGCATGCGTACGTCTTTTTTTTTTCTCCCTTCAAGGAAAAAACTG
ACATTGCCTGATACGTTATAGTCTATGGCCGTACTGCGAGTCGCAAGCGTGATCCAACGCTTCAGTCTGAAGACA
TGTGCAACACAGACTGCGCCTTGTTTACTGCCGTGCAATGCTTCACCGGCTGTGGCTGGCTGTACGTCCTTGTCT
CTTTGTATCATCATCGCCATCCTAGCTGCGTCCTGACACGACCCCATCCAGCTTCTCCTTTTTCAAACGTACCGA
GATTCGCCAGCAGTATGGCATCAAGGGCAGCGCATGGGGCGACTGCTGTGCCACGTACTGGTGCCACTGCTGCTC
TCTCATCCAGCAAGACAATGAAGTCAGGCTCAGACAGGCCGCCGCCGCCGCCAATGCTGCAGATGGCCCCATCAC
AAAGGCCTACGAGAGCCAGCAGCAGGGCATGTACATGCCTCCGTCTTTGCCCGTCAACGAGGCCCCCGAGAAACA
GAATCCAACGGTTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail