Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7657
Gene name
LocationContig_912:2202..4498
Strand-
Gene length (bp)2296
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 1.4E-15 115 219
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 7.2E-08 355 485
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 1.2E-06 257 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 64 474 2.0E-22
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 7 442 5.0E-21
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 43 474 1.0E-20
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 118 399 1.0E-20
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 64 473 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 64 474 2.0E-22
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 7 442 5.0E-21
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 43 474 1.0E-20
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 118 399 1.0E-20
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 64 473 2.0E-20
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 55 474 6.0E-20
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 55 474 2.0E-19
sp|O77695|BGLR_CHLAE Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops GN=GUSB PE=2 SV=1 55 474 1.0E-18
sp|Q9K9C6|BGAL_BACHD Beta-galactosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lacZ PE=3 SV=1 32 596 2.0E-18
sp|Q5R5N6|BGLR_PONAB Beta-glucuronidase OS=Pongo abelii GN=GUSB PE=2 SV=2 43 474 2.0E-18
sp|P12265|BGLR_MOUSE Beta-glucuronidase OS=Mus musculus GN=Gusb PE=1 SV=2 55 474 2.0E-18
sp|P08236|BGLR_HUMAN Beta-glucuronidase OS=Homo sapiens GN=GUSB PE=1 SV=2 43 474 2.0E-17
sp|P26257|BGAL_THETU Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes GN=lacZ PE=1 SV=1 119 468 2.0E-16
sp|Q56307|BGAL_THEMA Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lacZ PE=3 SV=2 119 470 8.0E-15
sp|A1SWB8|BGAL_PSYIN Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) GN=lacZ PE=3 SV=1 119 484 5.0E-13
sp|Q48727|BGAL_LACLA Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacZ PE=3 SV=3 64 452 1.0E-12
sp|O52847|BGAL_BACMD Beta-galactosidase OS=Bacillus megaterium (strain DSM 319) GN=bgaM PE=3 SV=1 65 397 4.0E-12
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 119 470 4.0E-11
sp|Q0CCA0|MANBB_ASPTN Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndB PE=3 SV=2 66 442 1.0E-08
sp|P0C1Y0|BGAL_LACDE Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=lacZ PE=1 SV=2 121 483 4.0E-08
sp|Q1G9Z4|BGAL_LACDA Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lacZ PE=3 SV=3 121 483 4.0E-08
sp|P81650|BGAL_PSEHA Beta-galactosidase OS=Pseudoalteromonas haloplanktis GN=lacZ PE=1 SV=2 279 468 1.0E-07
sp|B4S2K9|BGAL_ALTMD Beta-galactosidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=lacZ PE=3 SV=1 138 468 4.0E-07
sp|B2VHN8|BGAL_ERWT9 Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lacZ PE=3 SV=1 275 484 1.0E-06
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 263 470 1.0E-06
sp|Q03WL0|BGAL_LEUMM Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lacZ PE=3 SV=1 138 470 4.0E-06
sp|A8GGN3|BGAL_SERP5 Beta-galactosidase OS=Serratia proteamaculans (strain 568) GN=lacZ PE=3 SV=1 281 475 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7657
MHLTPAALGYAALLIGLCQAQQQLEKRAPTPYKVQKPPLDTDWTYKVGTDPWPEYPRPQLRRNEWQSLNGIWTFQ
GLKGNEEDLEALGSIAPEREILIPSCIESGLSGIQELNITNMWFERQFEVPKEWSNKTILLNFEAVDYETSVFVN
NVKVGSHVGGYFRFSIDITANVKHGQENRLLVAVYDPTDMDVIPVGKQTVNPRHIWYRPCSGIWQSVWMEAVAPN
YITKLDVSAGMDGVVNFKASSSRGSPTSLSFSVMDASGKVVATACAKSDTDSKVVVKDPLLWTPDSPHLYNISVT
MGQDKVDSYTGFRTISAGRVNDVQRPLLNGRFTFMFGTLDQGYWPDGIYTPPNREAMIYDLKLLKSLGFNTIRKH
IKVEPALFYQACDELGLMVIQDMPSLPDDHRRPPNAAQQLEFERQLELLINQLKSYTSIVTWIIYNEGWGQLRHA
PYPEEKLSKKVRSLDPTRLIDSVTGWHDHGFGDFSDNHHYANPQCGTPFSSIDSSPYDEARIGFQGEFGGIGHVV
DKHIWNVQDAIDTINQTYEISLDLDAYNYRAHVVLRELREQVELYACSGGLWTQTTDVEGEVNGLYTYDRRVLRP
YIKQWRDDIQSLYEAARGRGGA*
Coding >OphauG2|7657
ATGCATCTCACACCCGCCGCACTGGGCTATGCTGCCCTGCTCATTGGGCTATGCCAGGCGCAGCAGCAGCTGGAG
AAGCGCGCCCCAACGCCATACAAGGTGCAGAAGCCGCCTCTCGACACCGACTGGACATACAAGGTGGGCACGGAT
CCATGGCCCGAGTATCCCCGGCCACAGCTCCGGCGCAACGAGTGGCAAAGCCTCAATGGGATTTGGACGTTTCAA
GGCCTCAAGGGCAACGAGGAAGACCTGGAGGCGCTTGGCAGCATCGCGCCGGAGCGTGAGATTTTGATCCCGTCG
TGCATTGAGAGCGGGCTGTCTGGAATCCAGGAGCTCAACATTACGAATATGTGGTTTGAGCGACAATTCGAGGTG
CCCAAGGAGTGGAGCAACAAGACGATTCTGCTCAATTTTGAAGCGGTGGATTACGAAACAAGCGTCTTTGTCAAT
AATGTCAAGGTTGGCAGCCATGTTGGCGGATACTTTCGCTTTAGCATTGACATTACGGCCAATGTCAAGCATGGC
CAAGAAAACCGCCTACTAGTGGCCGTCTATGACCCAACAGACATGGATGTTATTCCCGTCGGCAAACAAACCGTC
AATCCAAGGCACATCTGGTATCGGCCCTGCTCAGGAATCTGGCAGAGCGTGTGGATGGAGGCCGTGGCGCCAAAC
TACATTACCAAGCTCGATGTCTCTGCCGGCATGGACGGTGTAGTCAACTTCAAGGCATCCAGCTCCCGCGGAAGC
CCAACGAGCCTCAGCTTCTCAGTCATGGACGCCAGCGGCAAAGTGGTGGCGACAGCATGCGCCAAGTCGGACACG
GACTCCAAGGTGGTGGTCAAGGACCCCTTGCTCTGGACGCCAGACTCGCCTCACCTCTACAACATCTCGGTGACC
ATGGGCCAGGACAAGGTGGACAGCTACACGGGCTTCCGCACCATCTCGGCTGGCCGGGTCAACGACGTGCAGCGG
CCGCTGCTCAACGGCCGCTTCACCTTTATGTTTGGCACGCTTGACCAGGGATACTGGCCAGATGGAATATACACG
CCGCCCAATCGCGAGGCCATGATTTACGACTTGAAGCTGCTCAAGTCTCTGGGCTTCAACACGATTCGAAAACAC
ATCAAGGTTGAGCCTGCGCTCTTTTACCAGGCGTGCGACGAGCTGGGCTTGATGGTCATCCAAGACATGCCCAGC
CTGCCAGACGACCACCGGCGTCCCCCAAACGCAGCACAGCAGCTGGAATTCGAGCGCCAACTCGAGCTTCTTATC
AACCAGTTGAAAAGCTACACGTCGATAGTCACATGGATTATTTACAACGAAGGTTGGGGCCAGCTGCGGCACGCG
CCATACCCCGAGGAAAAACTTAGCAAAAAGGTTCGAAGTCTGGATCCCACCAGGCTCATTGACTCGGTGACTGGC
TGGCATGACCACGGCTTCGGTGATTTTTCGGACAACCACCACTACGCCAACCCGCAATGCGGCACGCCCTTTTCC
TCGATAGATTCGTCTCCGTATGATGAGGCGCGCATCGGCTTCCAGGGCGAGTTTGGCGGCATCGGCCACGTTGTG
GATAAGCATATCTGGAATGTGCAAGACGCGATAGACACCATCAACCAGACGTACGAGATTAGCCTCGATCTGGAT
GCCTACAACTACAGAGCGCACGTTGTGCTCCGCGAGCTAAGGGAGCAGGTTGAGCTGTATGCATGCAGCGGCGGG
CTGTGGACGCAGACAACAGACGTCGAGGGCGAAGTCAATGGGCTGTACACGTATGACCGGCGGGTATTGCGGCCG
TATATCAAGCAGTGGAGAGACGATATTCAAAGCCTGTACGAGGCGGCTCGGGGACGGGGCGGGGCATGA
Transcript >OphauG2|7657
ATGCATCTCACACCCGCCGCACTGGGCTATGCTGCCCTGCTCATTGGGCTATGCCAGGCGCAGCAGCAGCTGGAG
AAGCGCGCCCCAACGCCATACAAGGTGCAGAAGCCGCCTCTCGACACCGACTGGACATACAAGGTGGGCACGGAT
CCATGGCCCGAGTATCCCCGGCCACAGCTCCGGCGCAACGAGTGGCAAAGCCTCAATGGGATTTGGACGTTTCAA
GGCCTCAAGGGCAACGAGGAAGACCTGGAGGCGCTTGGCAGCATCGCGCCGGAGCGTGAGATTTTGATCCCGTCG
TGCATTGAGAGCGGGCTGTCTGGAATCCAGGAGCTCAACATTACGAATATGTGGTTTGAGCGACAATTCGAGGTG
CCCAAGGAGTGGAGCAACAAGACGATTCTGCTCAATTTTGAAGCGGTGGATTACGAAACAAGCGTCTTTGTCAAT
AATGTCAAGGTTGGCAGCCATGTTGGCGGATACTTTCGCTTTAGCATTGACATTACGGCCAATGTCAAGCATGGC
CAAGAAAACCGCCTACTAGTGGCCGTCTATGACCCAACAGACATGGATGTTATTCCCGTCGGCAAACAAACCGTC
AATCCAAGGCACATCTGGTATCGGCCCTGCTCAGGAATCTGGCAGAGCGTGTGGATGGAGGCCGTGGCGCCAAAC
TACATTACCAAGCTCGATGTCTCTGCCGGCATGGACGGTGTAGTCAACTTCAAGGCATCCAGCTCCCGCGGAAGC
CCAACGAGCCTCAGCTTCTCAGTCATGGACGCCAGCGGCAAAGTGGTGGCGACAGCATGCGCCAAGTCGGACACG
GACTCCAAGGTGGTGGTCAAGGACCCCTTGCTCTGGACGCCAGACTCGCCTCACCTCTACAACATCTCGGTGACC
ATGGGCCAGGACAAGGTGGACAGCTACACGGGCTTCCGCACCATCTCGGCTGGCCGGGTCAACGACGTGCAGCGG
CCGCTGCTCAACGGCCGCTTCACCTTTATGTTTGGCACGCTTGACCAGGGATACTGGCCAGATGGAATATACACG
CCGCCCAATCGCGAGGCCATGATTTACGACTTGAAGCTGCTCAAGTCTCTGGGCTTCAACACGATTCGAAAACAC
ATCAAGGTTGAGCCTGCGCTCTTTTACCAGGCGTGCGACGAGCTGGGCTTGATGGTCATCCAAGACATGCCCAGC
CTGCCAGACGACCACCGGCGTCCCCCAAACGCAGCACAGCAGCTGGAATTCGAGCGCCAACTCGAGCTTCTTATC
AACCAGTTGAAAAGCTACACGTCGATAGTCACATGGATTATTTACAACGAAGGTTGGGGCCAGCTGCGGCACGCG
CCATACCCCGAGGAAAAACTTAGCAAAAAGGTTCGAAGTCTGGATCCCACCAGGCTCATTGACTCGGTGACTGGC
TGGCATGACCACGGCTTCGGTGATTTTTCGGACAACCACCACTACGCCAACCCGCAATGCGGCACGCCCTTTTCC
TCGATAGATTCGTCTCCGTATGATGAGGCGCGCATCGGCTTCCAGGGCGAGTTTGGCGGCATCGGCCACGTTGTG
GATAAGCATATCTGGAATGTGCAAGACGCGATAGACACCATCAACCAGACGTACGAGATTAGCCTCGATCTGGAT
GCCTACAACTACAGAGCGCACGTTGTGCTCCGCGAGCTAAGGGAGCAGGTTGAGCTGTATGCATGCAGCGGCGGG
CTGTGGACGCAGACAACAGACGTCGAGGGCGAAGTCAATGGGCTGTACACGTATGACCGGCGGGTATTGCGGCCG
TATATCAAGCAGTGGAGAGACGATATTCAAAGCCTGTACGAGGCGGCTCGGGGACGGGGCGGGGCATGA
Gene >OphauG2|7657
ATGCATCTCACACCCGCCGCACTGGGCTATGCTGCCCTGCTCATTGGGCTATGCCAGGCGCAGCAGCAGCTGGAG
AAGCGCGCCCCAACGCCATACAAGGTGCAGAAGCCGCCTCTCGACACCGACTGGACATACAAGGTGGGCACGGAT
CCATGGCCCGAGTATCCCCGGCCACAGCTCCGGCGCAACGAGTGGCAAAGCCTCAATGGGATTTGGACGTTTCAA
GGCCTCAAGGGCAACGAGGAAGACCTGGAGGCGCTTGGCAGCATCGCGCCGGAGCGTGAGATTTTGATCCCGTCG
TGCATTGAGAGCGGGCTGTCTGGAATCCAGGAGCTCAACATTACGAATATGTGGTTTGAGCGACAATTCGAGGTG
CCCAAGGAGTGGAGCAACAAGACGATTCTGCTCAATTTTGAAGCGGTGGATTACGAAACAAGCGTCTTTGTCAAT
AATGTCAAGGTTGGCAGCCATGTTGGCGGATACTTTCGCTTTAGCATTGACATTACGGCCAATGTCAAGCATGGC
CAAGAAAACCGCCTGTAAGCCTCTTGCTCGAGAAGAAGGAAGCATGATATGAAGCATAATGAAAAAGAAGAGAAG
CATAAGGAAAACAAAGAGAAGCATAATAAAAAAGAAGAGAAGCATTTTGGAAAAAAAGAGGAAAAAAACAAAAAA
AACAAAGACTAACCGTCAATGTACAGACTAGTGGCCGTCTATGACCCAACAGACATGGATGTTATTCCCGTCGGC
AAACAAACCGTCAATCCAAGGCACATCTGGTATCGGCCCTGCTCAGGAATCTGGCAGAGCGTGTGGATGGAGGCC
GTGGCGCCAAACTACATTACCAAGCTCGATGTCTCTGCCGGCATGGACGGTGTAGTCAACTTCAAGGCATCCAGC
TCCCGCGGAAGCCCAACGAGCCTCAGCTTCTCAGTCATGGACGCCAGCGGCAAAGTGGTGGCGACAGCATGCGCC
AAGTCGGACACGGACTCCAAGGTGGTGGTCAAGGACCCCTTGCTCTGGACGCCAGACTCGCCTCACCTCTACAAC
ATCTCGGTGACCATGGGCCAGGACAAGGTGGACAGCTACACGGGCTTCCGCACCATCTCGGCTGGCCGGGTCAAC
GACGTGCAGCGGCCGCTGCTCAACGGCCGCTTCACCTTTATGTTTGGCACGCTTGACCAGGGATACTGGCCAGAT
GGAATATACACGCCGCCCAATCGCGAGGCCATGATTTACGACTTGAAGCTGCTCAAGTCTCTGGGCTTCAACACG
ATTCGAAAACACGTTGGTCTCATGGATTGTCTCGCAGGCTGTGCTCGCTACTGACGCTTTGAGACGGCAGATCAA
GGTTGAGCCTGCGCTCTTTTACCAGGCGTGCGACGAGCTGGGCTTGATGGTCATCCAAGACATGCCCAGCCTGCC
AGACGACCACCGGCGTCCCCCAAACGCAGCACAGCAGCTGGAATTCGAGCGCCAACTCGAGCTTCTTATCAACCA
GTTGAAAAGCTACACGTCGATAGTCACATGGGTCAGTCGCACCATGGTGGAAGCCAATCATGGGCGATTCATCAA
TTAACATTTTCTCCCTTGCTGGATAGATTATTTACAACGAAGGTTGGGGCCAGCTGCGGCACGCGCCATACCCCG
AGGAAAAACTTAGCAAAAAGGTTCGAAGTCTGGATCCCACCAGGCTCATTGACTCGGTGACTGGCTGGCATGACC
ACGGCTTCGGTGATTTTTCGGTACAGTGGCCAAAGCACAGCTTCGAGCGCGCGCGTTGAGAGCTAACGAGAAACC
ATGACAGGACAACCACCACTACGCCAACCCGCAATGCGGCACGCCCTTTTCCTCGATAGATTCGTCTCCGTATGA
TGAGGCGCGCATCGGCTTCCAGGGCGAGTTTGGCGGCATCGGCCACGTTGTGGATAAGCAGTAAGGGCCTATCCT
CCCTCTGCCAAGACTCTGGCCATGTGTGTGTTTTTTTTTTTTTAACTCGAATGGGCACAGTATCTGGAATGTGCA
AGACGCGATAGACACCATCAACCAGACGTACGAGATTAGCCTCGATCTGGATGCCTACAACTACAGAGCGCACGT
TGTGCTCCGCGAGCTAAGGGAGCAGGTTGAGCTGTATGCATGCAGCGGCGGGCTGTGGACGCAGACAACAGACGT
CGAGGGCGAAGTCAATGGGCTGTACACGTATGACCGGCGGGTATTGCGGCCGTATATCAAGCAGTGGAGAGACGA
TATTCAAAGCCTGTACGAGGCGGCTCGGGGACGGGGCGGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail