Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|764
Gene name
LocationContig_12:22410..25343
Strand+
Gene length (bp)2933
Transcript length (bp)2652
Coding sequence length (bp)2652
Protein length (aa) 884

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1 2.6E-51 337 698

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX87|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2 166 825 4.0E-49
sp|Q94A08|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2 339 766 6.0E-44
sp|Q84VX0|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1 343 828 7.0E-36
sp|Q5VQG4|RFS_ORYSJ Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1 316 696 3.0E-33
sp|Q9FND9|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1 341 696 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX87|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2 166 825 4.0E-49
sp|Q94A08|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2 339 766 6.0E-44
sp|Q84VX0|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1 343 828 7.0E-36
sp|Q5VQG4|RFS_ORYSJ Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1 316 696 3.0E-33
sp|Q9FND9|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1 341 696 2.0E-31
sp|Q8VWN6|RFS_PEA Galactinol--sucrose galactosyltransferase OS=Pisum sativum GN=RFS PE=1 SV=1 281 699 4.0E-30
sp|Q97U94|AGAL_SULSO Alpha-galactosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=galS PE=1 SV=2 315 699 4.0E-29
sp|Q9SYJ4|RFS4_ARATH Probable galactinol--sucrose galactosyltransferase 4 OS=Arabidopsis thaliana GN=RFS4 PE=2 SV=3 411 696 2.0E-23
sp|Q93XK2|STSYN_PEA Stachyose synthase OS=Pisum sativum GN=STS1 PE=1 SV=1 396 721 3.0E-23
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6721
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|764 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4385
Ophiocordyceps subramaniannii Hirsu2|7046

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|764
MSSEPYSFTADFNKNYISKQKPPPPSDYIMKPHLQSYPPLGQVTVVARGLDIDLTAVLRVPASLCPESCQVALWS
SADGAQWSETALNSISLDKDKPSSLQTLAESSSVLFFSCSVSVSCFLQFTFKIRTGPHEPWTWVRDDQGFEDGLV
VSMLSAAVSEPNCLPISNFNNAWKVTSLLSQAPQTVLWSLESHLSPASGDVSSFENIDIGMPWGSYSRWFALVRV
WSPWLAPRQGKDHFVLDQDAIICSFLSSKGPSLVFLALNGLDNVLTTFCSTADGRISVNARNDSVTAQKATILVA
ESHEFERALAAVMYHARTILSQHTGLTAITKDETLDDKWYDGLGYCTWNGLGQRLTAQKVLDAVQKLVKNKIHIT
SLIIDDNWQSIDYKGESQFQYGWVEFEADAKAFPKGLKALVSQLRQQHPSVQHISVWHSLLGYWGGIAPGGKLDQ
EYKTVRVDREQSRRRNLPLGGPMTVVAKEDVRRLYQDFYDFLCDAGIDGVKTDSQFMVDVLSSASVRRELIKTYL
DSWTKASLERFGARAISCMSQIPQALFHCQLMQNRPPTVVRNSDDFFPEVEASHPWHIWTNAHNAVFTQFLNVLP
DWDMFQTVHDYSGFHAAARCVSGGPIYITDVPGKHNMDLIRQMTGITPRGQTIIFRPSVVGRSIHPYMGYDDDAL
LKIGSYHGRAQVGTGILGVFNVSARALTELIPLESFPGTLSCLNYIVRAHTTGKVSMPIKVGQRPSLLVTWLDVR
GFEIYCAYPLTHFTGNKHSGGWTSNLGLVGKMTGCAAIINSTVSQNEHGRVVMETQLKALGVVGIYVSTLPSMTI
DGDFMATLQKQPVPRHCVKVSHNDGCVLEMDIERAWREMRLDAGAAVNTADVMVAWSV*
Coding >OphauG2|764
ATGTCTTCTGAACCGTACAGCTTCACGGCCGATTTCAACAAGAATTACATCTCAAAGCAAAAACCTCCCCCGCCA
TCTGACTACATCATGAAACCTCATCTTCAAAGCTACCCTCCCTTGGGTCAAGTGACTGTGGTGGCCAGAGGCCTT
GACATTGATCTTACCGCTGTACTGCGTGTCCCAGCCTCTCTGTGCCCCGAGTCCTGCCAGGTGGCTCTATGGTCC
TCTGCGGACGGAGCTCAATGGTCAGAGACGGCCCTTAATTCCATATCTCTTGACAAGGACAAGCCCTCCAGTCTC
CAGACTCTGGCCGAATCGAGTTCTGTGTTATTTTTTTCTTGCTCTGTATCCGTGTCGTGTTTCCTGCAATTCACC
TTCAAAATTCGTACCGGGCCTCATGAGCCCTGGACATGGGTTCGTGATGACCAAGGCTTCGAGGACGGACTTGTC
GTGTCAATGCTTTCTGCCGCAGTCTCTGAGCCAAATTGTCTCCCAATTTCAAACTTTAACAACGCCTGGAAAGTC
ACATCGCTGCTGAGCCAGGCGCCTCAGACAGTCCTGTGGTCTCTCGAATCTCATCTCTCTCCAGCAAGCGGTGAT
GTATCGAGCTTTGAAAATATTGACATTGGTATGCCATGGGGGTCATATTCAAGATGGTTTGCCCTCGTACGCGTC
TGGTCTCCATGGCTTGCTCCTAGACAAGGCAAGGATCACTTTGTCCTTGATCAAGACGCCATAATTTGCTCCTTT
CTGAGCTCCAAAGGACCGAGTCTCGTCTTTCTTGCCCTGAATGGGCTCGATAACGTCTTGACAACATTTTGCAGC
ACCGCGGACGGCAGGATATCTGTCAATGCTCGAAATGACAGTGTGACGGCCCAGAAAGCCACCATCTTAGTGGCA
GAGAGCCATGAGTTTGAACGCGCCCTGGCCGCTGTCATGTATCATGCCAGGACAATTCTATCGCAGCACACAGGT
CTCACGGCAATAACAAAAGACGAGACTCTGGACGACAAGTGGTACGATGGGCTTGGATATTGTACCTGGAATGGA
TTGGGCCAGAGACTGACAGCGCAAAAGGTGCTTGATGCCGTGCAAAAACTGGTGAAAAACAAGATTCACATCACC
AGCCTCATCATAGATGACAATTGGCAGTCAATTGACTACAAAGGAGAAAGCCAATTTCAGTATGGCTGGGTTGAG
TTTGAGGCCGATGCCAAGGCCTTCCCCAAGGGCCTCAAGGCATTAGTCTCGCAACTTCGACAACAGCACCCTAGC
GTCCAACACATCTCGGTTTGGCATTCTCTGCTAGGCTACTGGGGCGGCATAGCTCCAGGGGGCAAGTTGGACCAA
GAGTACAAGACAGTCAGGGTTGACCGTGAGCAGTCGCGGCGCCGCAATCTCCCTCTGGGCGGCCCCATGACGGTT
GTTGCCAAGGAGGACGTGAGGCGCCTCTACCAAGACTTTTATGACTTTCTTTGCGACGCAGGCATCGACGGGGTC
AAAACCGACAGCCAGTTCATGGTTGATGTCTTGTCCAGTGCCTCGGTGCGTCGAGAGCTTATCAAGACTTACCTG
GACTCATGGACCAAGGCATCTCTGGAGCGTTTCGGAGCCAGGGCCATCTCGTGCATGTCGCAGATACCACAGGCT
CTATTCCACTGCCAGCTCATGCAAAATCGGCCACCAACAGTGGTGCGCAACTCGGACGACTTCTTCCCCGAGGTT
GAAGCGTCGCATCCGTGGCACATATGGACCAACGCCCACAATGCCGTCTTTACCCAGTTCTTGAATGTGCTTCCC
GACTGGGACATGTTCCAGACGGTGCATGATTACTCGGGCTTCCACGCGGCAGCAAGGTGTGTTAGCGGTGGTCCG
ATATACATTACAGATGTGCCGGGGAAGCACAACATGGACTTGATCCGGCAGATGACAGGCATCACACCCAGGGGC
CAAACTATTATCTTTAGGCCCAGCGTTGTAGGGAGGTCTATCCACCCATACATGGGATATGACGACGACGCCTTG
CTCAAAATTGGGAGCTATCATGGGAGAGCGCAGGTTGGTACTGGCATCTTGGGCGTCTTCAATGTTTCTGCGCGA
GCCTTGACCGAATTGATACCTTTGGAGAGTTTCCCAGGGACACTATCTTGCCTCAACTACATTGTGCGCGCGCAC
ACGACAGGCAAGGTGTCGATGCCAATCAAAGTCGGACAGAGGCCGTCTCTACTTGTGACGTGGTTGGACGTGCGA
GGATTCGAGATTTATTGCGCTTACCCCCTGACTCACTTTACCGGCAACAAGCACAGCGGCGGCTGGACGTCGAAT
CTTGGCCTGGTGGGAAAGATGACGGGCTGTGCTGCCATTATCAACAGCACCGTCAGCCAGAATGAACATGGCAGG
GTGGTGATGGAAACGCAGCTCAAGGCTTTGGGCGTGGTTGGCATCTACGTGTCGACGCTGCCGTCAATGACAATT
GACGGGGACTTTATGGCCACGTTGCAGAAGCAGCCGGTGCCTCGACATTGTGTCAAGGTGTCGCACAATGATGGC
TGTGTCTTGGAGATGGACATCGAGAGGGCGTGGAGGGAGATGCGTCTTGATGCTGGCGCTGCTGTCAACACGGCG
GACGTCATGGTTGCTTGGAGTGTTTGA
Transcript >OphauG2|764
ATGTCTTCTGAACCGTACAGCTTCACGGCCGATTTCAACAAGAATTACATCTCAAAGCAAAAACCTCCCCCGCCA
TCTGACTACATCATGAAACCTCATCTTCAAAGCTACCCTCCCTTGGGTCAAGTGACTGTGGTGGCCAGAGGCCTT
GACATTGATCTTACCGCTGTACTGCGTGTCCCAGCCTCTCTGTGCCCCGAGTCCTGCCAGGTGGCTCTATGGTCC
TCTGCGGACGGAGCTCAATGGTCAGAGACGGCCCTTAATTCCATATCTCTTGACAAGGACAAGCCCTCCAGTCTC
CAGACTCTGGCCGAATCGAGTTCTGTGTTATTTTTTTCTTGCTCTGTATCCGTGTCGTGTTTCCTGCAATTCACC
TTCAAAATTCGTACCGGGCCTCATGAGCCCTGGACATGGGTTCGTGATGACCAAGGCTTCGAGGACGGACTTGTC
GTGTCAATGCTTTCTGCCGCAGTCTCTGAGCCAAATTGTCTCCCAATTTCAAACTTTAACAACGCCTGGAAAGTC
ACATCGCTGCTGAGCCAGGCGCCTCAGACAGTCCTGTGGTCTCTCGAATCTCATCTCTCTCCAGCAAGCGGTGAT
GTATCGAGCTTTGAAAATATTGACATTGGTATGCCATGGGGGTCATATTCAAGATGGTTTGCCCTCGTACGCGTC
TGGTCTCCATGGCTTGCTCCTAGACAAGGCAAGGATCACTTTGTCCTTGATCAAGACGCCATAATTTGCTCCTTT
CTGAGCTCCAAAGGACCGAGTCTCGTCTTTCTTGCCCTGAATGGGCTCGATAACGTCTTGACAACATTTTGCAGC
ACCGCGGACGGCAGGATATCTGTCAATGCTCGAAATGACAGTGTGACGGCCCAGAAAGCCACCATCTTAGTGGCA
GAGAGCCATGAGTTTGAACGCGCCCTGGCCGCTGTCATGTATCATGCCAGGACAATTCTATCGCAGCACACAGGT
CTCACGGCAATAACAAAAGACGAGACTCTGGACGACAAGTGGTACGATGGGCTTGGATATTGTACCTGGAATGGA
TTGGGCCAGAGACTGACAGCGCAAAAGGTGCTTGATGCCGTGCAAAAACTGGTGAAAAACAAGATTCACATCACC
AGCCTCATCATAGATGACAATTGGCAGTCAATTGACTACAAAGGAGAAAGCCAATTTCAGTATGGCTGGGTTGAG
TTTGAGGCCGATGCCAAGGCCTTCCCCAAGGGCCTCAAGGCATTAGTCTCGCAACTTCGACAACAGCACCCTAGC
GTCCAACACATCTCGGTTTGGCATTCTCTGCTAGGCTACTGGGGCGGCATAGCTCCAGGGGGCAAGTTGGACCAA
GAGTACAAGACAGTCAGGGTTGACCGTGAGCAGTCGCGGCGCCGCAATCTCCCTCTGGGCGGCCCCATGACGGTT
GTTGCCAAGGAGGACGTGAGGCGCCTCTACCAAGACTTTTATGACTTTCTTTGCGACGCAGGCATCGACGGGGTC
AAAACCGACAGCCAGTTCATGGTTGATGTCTTGTCCAGTGCCTCGGTGCGTCGAGAGCTTATCAAGACTTACCTG
GACTCATGGACCAAGGCATCTCTGGAGCGTTTCGGAGCCAGGGCCATCTCGTGCATGTCGCAGATACCACAGGCT
CTATTCCACTGCCAGCTCATGCAAAATCGGCCACCAACAGTGGTGCGCAACTCGGACGACTTCTTCCCCGAGGTT
GAAGCGTCGCATCCGTGGCACATATGGACCAACGCCCACAATGCCGTCTTTACCCAGTTCTTGAATGTGCTTCCC
GACTGGGACATGTTCCAGACGGTGCATGATTACTCGGGCTTCCACGCGGCAGCAAGGTGTGTTAGCGGTGGTCCG
ATATACATTACAGATGTGCCGGGGAAGCACAACATGGACTTGATCCGGCAGATGACAGGCATCACACCCAGGGGC
CAAACTATTATCTTTAGGCCCAGCGTTGTAGGGAGGTCTATCCACCCATACATGGGATATGACGACGACGCCTTG
CTCAAAATTGGGAGCTATCATGGGAGAGCGCAGGTTGGTACTGGCATCTTGGGCGTCTTCAATGTTTCTGCGCGA
GCCTTGACCGAATTGATACCTTTGGAGAGTTTCCCAGGGACACTATCTTGCCTCAACTACATTGTGCGCGCGCAC
ACGACAGGCAAGGTGTCGATGCCAATCAAAGTCGGACAGAGGCCGTCTCTACTTGTGACGTGGTTGGACGTGCGA
GGATTCGAGATTTATTGCGCTTACCCCCTGACTCACTTTACCGGCAACAAGCACAGCGGCGGCTGGACGTCGAAT
CTTGGCCTGGTGGGAAAGATGACGGGCTGTGCTGCCATTATCAACAGCACCGTCAGCCAGAATGAACATGGCAGG
GTGGTGATGGAAACGCAGCTCAAGGCTTTGGGCGTGGTTGGCATCTACGTGTCGACGCTGCCGTCAATGACAATT
GACGGGGACTTTATGGCCACGTTGCAGAAGCAGCCGGTGCCTCGACATTGTGTCAAGGTGTCGCACAATGATGGC
TGTGTCTTGGAGATGGACATCGAGAGGGCGTGGAGGGAGATGCGTCTTGATGCTGGCGCTGCTGTCAACACGGCG
GACGTCATGGTTGCTTGGAGTGTTTGA
Gene >OphauG2|764
ATGTCTTCTGAACCGTACAGCTTCACGGCCGATTTCAACAAGAATTACATCTCAAAGCAAAAACCTCCCCCGCCA
TCTGACTACATCATGAAACCTCATCTTCAAAGCTACCCTCCCTTGGGTCAAGTGACTGTGGTGGCCAGAGGCCTT
GACATTGATCTTACCGCTGTACTGCGTGTCCCAGCCTCTCTGTGCCCCGAGTCCTGCCAGGTGGCTCTATGGTCC
TCTGCGGACGGAGCTCAATGGTCAGAGACGGCCCTTAATTCCATATCTCTTGACAAGGACAAGCCCTCCAGTCTC
CAGACTCTGGCCGAATCGAGTTCTGTGTTATTTTTTTCTTGCTCTGTATCCGTGTCGTGTTTCCTGCAATTCACC
TTCAAAATTCGTACCGGGCCTCATGAGCCCTGGACATGGGTTCGTGATGACCAAGGCTTCGAGGACGGACTTGTC
GTGTCAATGCTTTCTGCCGCAGTCTCTGAGCCAAATTGTCTCCCAATTTCAAACTTTAACAACGCCTGGAAAGTC
ACATCGCTGCTGAGCCAGGCGCCTCAGACAGTCCTGTGGTCTCTCGAATCTCATCTCTCTCCAGCAAGCGGTGAT
GTATCGAGCTTTGAAAATATTGACATTGGTATGCCATGGGGGTCATATTCAAGGTGAGAAGAGCGATTTGGGTGT
CATCATCCACTCTGCTGATGTCCACAAGCAGATGGTTTGCCCTCGTACGCGTCTGGTCTCCATGGCTTGCTCCTA
GACAAGGCAAGGATCACTTTGTCCTTGATCAAGACGCCATAATTTGCTCCTTTCTGAGCTCCAAAGGACCGAGTC
TCGTCTTTCTTGCCCTGAATGGGCTCGATAACGTCTTGACAACATTTTGCAGCACCGCGGACGGCAGGATATCTG
TCAATGTATGAGCATTGGTCCTCTCTCATGCTGCGAATACTTATGTTATTAGGCTCGAAATGACAGTGTGACGGC
CCAGAAAGCCACCATCTTAGTGGCAGAGAGCCATGAGTTTGAACGCGCCCTGGCCGCTGTCATGTATCATGCCAG
GACAATTCTATCGCAGCACACAGGTCTCACGGCAATAACAAAAGACGAGACTCTGGACGACAAGTGGTACGATGG
GCTTGGATATTGTCAGTCCTTGTATTCTTGCCTGTTCCTTGTACCACTGACTCATCTGATTCAGGTACCTGGAAT
GGATTGGGCCAGAGACTGACAGCGCAAAAGGTGCTTGATGCCGTGCAAAAACTGGTGAAAAACAAGATTCACATC
ACCAGCCTCATCATAGATGACAATTGGCAGTCAATTGACTACAAAGGAGAAAGCCAATTTCAGTATGGCTGGGTT
GAGTTTGAGGCCGATGCCAAGGCCTTCCCCAAGGGCCTCAAGGCATTAGTCTCGCAACTTCGACAACAGCACCCT
AGCGTCCAACACATCTCGGTTTGGCATTCTCTGCTAGGCTACTGGGGCGGCATAGCTCCAGGGGGCAAGTTGGAC
CAAGAGTACAAGACAGTCAGGGTTGACCGTGAGCAGTCGCGGCGCCGCAATCTCCCTCTGGGCGGCCCCATGACG
GTTGTTGCCAAGGAGGACGTGAGGCGCCTCTACCAAGACTTTTATGACTTTCTTTGCGACGCAGGCATCGACGGG
GTCAAAACCGACAGCCAGTTCATGGTTGATGTCTTGTCCAGTGCCTCGGTGCGTCGAGAGCTTATCAAGACTTAC
CTGGACTCATGGACCAAGGCATCTCTGGAGCGTTTCGGAGCCAGGGCCATCTCGTGCATGTCGCAGATACCACAG
GCTCTATTCCACTGCCAGCTCATGCAAAATCGGCCACCAACAGTGGTGCGCAACTCGGACGACTTCTTCCCCGAG
GTTGAAGCGTCGCATCCGTGGCACATATGGACCAACGCCCACAATGCCGTCTTTACCCAGTTCTTGAATGTGCTT
CCCGACTGGGACATGTTCCAGACGGTGCATGATTACTCGGGCTTCCACGCGGCAGCAAGGTGTGTTAGCGGTGGT
CCGATATACATTACAGATGTGCCGGGGAAGCACAACATGGACTTGATCCGGCAGATGACAGGCATCACACCCAGG
GGCCAAACTATTATCTTTAGGCCCAGCGTTGTAGGGAGGTCTATCCACCCATACATGGGATATGACGACGACGCC
TTGCTCAAAATTGGGAGCTATCATGGTAGGAGATGGGGATGTTCTGGATTGCACATGTAAGAGACATACTGACTG
GCGTTGCAGGGAGAGCGCAGGTTGGTACTGGCATCTTGGGCGTCTTCAATGTTTCTGCGCGAGCCTTGACCGAAT
TGATACCTTTGGAGAGTTTCCCAGGGACACTATCTTGCCTCAACTACATTGTGCGCGCGCACACGACAGGCAAGG
TGTCGATGCCAATCAAAGTCGGACAGAGGCCGTCTCTACTTGTGACGTGGTTGGACGTGCGAGGATTCGAGATTT
ATTGCGCTTACCCCCTGACTCACTTTACCGGCAACAAGCACAGCGGCGGCTGGACGTCGAATCTTGGCCTGGTGG
GAAAGATGACGGGCTGTGCTGCCATTATCAACAGCACCGTCAGCCAGAATGAACATGGCAGGGTGGTGATGGAAA
CGCAGCTCAAGGCTTTGGGCGTGGTTGGTGAGAGATATTTTTTGGGCCTCTCCAATGCTGTTATGCATCATGGAC
TGCTGACTCGGCTTTTTCCAGGCATCTACGTGTCGACGCTGCCGTCAATGACAATTGACGGGGACTTTATGGCCA
CGTTGCAGAAGCAGCCGGTGCCTCGACATTGTGTCAAGGTGTCGCACAATGATGGCTGTGTCTTGGAGATGGACA
TCGAGAGGGCGTGGAGGGAGATGCGTCTTGATGCTGGCGCTGCTGTCAACACGGCGGACGTCATGGTTGCTTGGA
GTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail