Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7631
Gene name
LocationContig_907:1462..2299
Strand+
Gene length (bp)837
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02114 Phosducin Phosducin 1.1E-14 71 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12017|PLP2_YEAST Phosducin-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLP2 PE=1 SV=1 5 250 2.0E-53
sp|Q9Y7L1|YGI9_SCHPO Phosducin-like protein C2A9.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.09 PE=1 SV=2 15 230 2.0E-45
sp|Q8MR62|VIAF1_DROME Viral IAP-associated factor homolog OS=Drosophila melanogaster GN=viaf PE=1 SV=1 13 213 5.0E-30
sp|Q4KLJ8|PDCL3_RAT Phosducin-like protein 3 OS=Rattus norvegicus GN=Pdcl3 PE=1 SV=1 13 213 5.0E-27
sp|Q5RB77|PDCL3_PONAB Phosducin-like protein 3 OS=Pongo abelii GN=PDCL3 PE=2 SV=1 13 218 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12017|PLP2_YEAST Phosducin-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLP2 PE=1 SV=1 5 250 2.0E-53
sp|Q9Y7L1|YGI9_SCHPO Phosducin-like protein C2A9.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.09 PE=1 SV=2 15 230 2.0E-45
sp|Q8MR62|VIAF1_DROME Viral IAP-associated factor homolog OS=Drosophila melanogaster GN=viaf PE=1 SV=1 13 213 5.0E-30
sp|Q4KLJ8|PDCL3_RAT Phosducin-like protein 3 OS=Rattus norvegicus GN=Pdcl3 PE=1 SV=1 13 213 5.0E-27
sp|Q5RB77|PDCL3_PONAB Phosducin-like protein 3 OS=Pongo abelii GN=PDCL3 PE=2 SV=1 13 218 8.0E-26
sp|Q32LN3|PDCL2_BOVIN Phosducin-like protein 2 OS=Bos taurus GN=PDCL2 PE=2 SV=1 13 218 5.0E-24
sp|Q8N4E4|PDCL2_HUMAN Phosducin-like protein 2 OS=Homo sapiens GN=PDCL2 PE=1 SV=2 13 228 5.0E-24
sp|Q9H2J4|PDCL3_HUMAN Phosducin-like protein 3 OS=Homo sapiens GN=PDCL3 PE=1 SV=1 13 218 1.0E-23
sp|Q78Y63|PDCL2_MOUSE Phosducin-like protein 2 OS=Mus musculus GN=Pdcl2 PE=1 SV=1 13 228 1.0E-23
sp|Q6P268|PDCL3_DANRE Phosducin-like protein 3 OS=Danio rerio GN=pdcl3 PE=2 SV=1 13 229 2.0E-23
sp|Q0VCW8|PDCL3_BOVIN Phosducin-like protein 3 OS=Bos taurus GN=PDCL3 PE=2 SV=1 13 213 8.0E-22
sp|Q8BVF2|PDCL3_MOUSE Phosducin-like protein 3 OS=Mus musculus GN=Pdcl3 PE=1 SV=1 13 213 2.0E-21
sp|Q71A38|PHLP2_DICDI Phosducin-like protein 2 OS=Dictyostelium discoideum GN=phlp2 PE=2 SV=2 20 195 7.0E-20
sp|Q13371|PHLP_HUMAN Phosducin-like protein OS=Homo sapiens GN=PDCL PE=1 SV=3 71 221 2.0E-08
sp|Q9DBX2|PHLP_MOUSE Phosducin-like protein OS=Mus musculus GN=Pdcl PE=1 SV=1 72 221 3.0E-08
sp|P20942|PHOS_RAT Phosducin OS=Rattus norvegicus GN=Pdc PE=1 SV=1 71 232 3.0E-08
sp|Q63737|PHLP_RAT Phosducin-like protein OS=Rattus norvegicus GN=Pdcl PE=1 SV=1 72 221 1.0E-07
sp|Q9QW08|PHOS_MOUSE Phosducin OS=Mus musculus GN=Pdc PE=2 SV=1 71 232 2.0E-07
sp|Q2HJA9|PHLP_BOVIN Phosducin-like protein OS=Bos taurus GN=PDCL PE=2 SV=1 71 227 2.0E-07
sp|P20941|PHOS_HUMAN Phosducin OS=Homo sapiens GN=PDC PE=1 SV=1 74 232 3.0E-07
sp|Q9XS39|PHOS_HORSE Phosducin OS=Equus caballus GN=PDC PE=2 SV=1 71 231 2.0E-06
sp|P19632|PHOS_BOVIN Phosducin OS=Bos taurus GN=PDC PE=1 SV=2 72 223 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7631
MAAPNEQRIAVPIDDPNADTEWNDILRKHGVIPEKPPSPTPLIEEALVEGRRLAHENRLEGKDIDQLDQLEDLED
EEFLNQYREKRMQEMRSLQKKAIHGSVYPISKPDYQREITEASINGPVLVNLTSTGANVESRVLSELWIQAAKEY
GDVKFCQMRASQAIENYPDRNCPTILVYKNGDIVKQVATLATLGGPRIKMQQIDDLLVHVGAVAETDLRVVKRRQ
AADEDDEQEQGQGQKTVKTGTVGRLQADDDDDWD*
Coding >OphauG2|7631
ATGGCCGCACCGAATGAACAGCGTATTGCTGTTCCTATTGATGACCCAAACGCAGATACTGAGTGGAATGATATT
CTGAGAAAGCATGGCGTGATTCCAGAAAAACCACCTAGCCCGACACCGCTCATAGAGGAAGCATTGGTTGAGGGA
CGACGACTCGCACATGAGAACCGGCTCGAAGGCAAAGATATTGACCAACTTGACCAACTCGAGGACCTTGAGGAC
GAAGAATTCTTGAACCAATACCGAGAAAAACGCATGCAAGAGATGCGCAGCTTACAGAAAAAAGCCATCCATGGC
AGTGTCTACCCTATTTCAAAACCCGATTACCAGCGTGAAATAACCGAAGCTTCCATCAACGGCCCCGTACTCGTC
AACCTGACCTCGACTGGCGCCAATGTCGAGTCGCGAGTCTTGTCCGAGCTCTGGATCCAAGCGGCAAAGGAATAC
GGCGACGTCAAGTTTTGTCAAATGCGGGCCAGCCAGGCTATTGAAAACTACCCTGATCGCAACTGTCCGACAATC
CTGGTATACAAAAATGGCGATATTGTCAAGCAGGTGGCCACCTTGGCGACTTTGGGCGGGCCACGCATCAAGATG
CAGCAGATTGATGATTTGCTCGTCCACGTTGGAGCTGTTGCGGAAACTGATTTGCGAGTTGTCAAGCGCCGACAA
GCCGCAGATGAAGATGACGAGCAGGAGCAGGGGCAGGGCCAAAAAACCGTCAAAACAGGCACCGTGGGGCGCTTG
CAAGCGGACGACGATGACGACTGGGATTAG
Transcript >OphauG2|7631
ATGGCCGCACCGAATGAACAGCGTATTGCTGTTCCTATTGATGACCCAAACGCAGATACTGAGTGGAATGATATT
CTGAGAAAGCATGGCGTGATTCCAGAAAAACCACCTAGCCCGACACCGCTCATAGAGGAAGCATTGGTTGAGGGA
CGACGACTCGCACATGAGAACCGGCTCGAAGGCAAAGATATTGACCAACTTGACCAACTCGAGGACCTTGAGGAC
GAAGAATTCTTGAACCAATACCGAGAAAAACGCATGCAAGAGATGCGCAGCTTACAGAAAAAAGCCATCCATGGC
AGTGTCTACCCTATTTCAAAACCCGATTACCAGCGTGAAATAACCGAAGCTTCCATCAACGGCCCCGTACTCGTC
AACCTGACCTCGACTGGCGCCAATGTCGAGTCGCGAGTCTTGTCCGAGCTCTGGATCCAAGCGGCAAAGGAATAC
GGCGACGTCAAGTTTTGTCAAATGCGGGCCAGCCAGGCTATTGAAAACTACCCTGATCGCAACTGTCCGACAATC
CTGGTATACAAAAATGGCGATATTGTCAAGCAGGTGGCCACCTTGGCGACTTTGGGCGGGCCACGCATCAAGATG
CAGCAGATTGATGATTTGCTCGTCCACGTTGGAGCTGTTGCGGAAACTGATTTGCGAGTTGTCAAGCGCCGACAA
GCCGCAGATGAAGATGACGAGCAGGAGCAGGGGCAGGGCCAAAAAACCGTCAAAACAGGCACCGTGGGGCGCTTG
CAAGCGGACGACGATGACGACTGGGATTAG
Gene >OphauG2|7631
ATGGCCGCACCGAATGAACAGCGTATTGCTGTTCCTATTGATGACCCAAACGCAGATACTGAGTGGTAGGCATTT
CCTCCACCATTGCCCATGAGAATGAATACCTAACACAGCTGCGACAGGAATGATATTCTGAGAAAGCATGGCGTG
ATTCCAGAAAAACCACCTAGCCCGACACCGCTCATAGAGGAAGCATTGGTTGAGGGACGACGACTCGCACATGAG
AACCGGCTCGAAGGCAAAGATATTGACCAACTTGACCAACTCGAGGACCTTGAGGACGAAGAATTCTTGAACCAA
TACCGAGAAAAACGCATGCAAGAGATGCGCAGCTTACAGAAAAAAGCCATCCATGGCAGTGTCTACCCTATTTCA
AAACCCGATTACCAGCGTGAAATAACCGAAGCTTCCATCAACGGCCCCGTACTCGTCAACCTGACCTCGACTGGC
GCCAATGTCGAGTCGCGAGTCTTGTCCGAGCTCTGGATCCAAGCGGCAAAGGAATACGGCGACGTCAAGTTTTGT
CAAATGCGGGCCAGCCAGGCTATTGAAAACTACCCTGATCGCAACTGTCCGACAATCCTGGTATACAAAAATGGC
GATATTGTCAAGCAGGTGGCCACCTTGGCGACTTTGGGCGGGCCACGCATCAAGATGCAGCAGATTGATGATTTG
CTCGTCCACGTTGGAGCTGTTGCGGAAACTGATTTGCGAGTTGTCAAGCGCCGACAAGCCGCAGATGAAGATGAC
GAGCAGGAGCAGGGGCAGGGCCAAAAAACCGTCAAAACAGGCACCGTGGGGCGCTTGCAAGCGGACGACGATGAC
GACTGGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail