Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|763
Gene name
LocationContig_12:20338..21994
Strand-
Gene length (bp)1656
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 2.2E-56 47 193
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 6.7E-36 199 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 10 467 0.0E+00
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 1 467 0.0E+00
sp|Q00302|MPPB_BLAEM Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1 25 467 0.0E+00
sp|Q9P7X1|MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr1 PE=2 SV=1 20 467 0.0E+00
sp|P10507|MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS1 PE=1 SV=1 15 453 4.0E-164
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 10 467 0.0E+00
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 1 467 0.0E+00
sp|Q00302|MPPB_BLAEM Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1 25 467 0.0E+00
sp|Q9P7X1|MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr1 PE=2 SV=1 20 467 0.0E+00
sp|P10507|MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS1 PE=1 SV=1 15 453 4.0E-164
sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 16 468 9.0E-160
sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 3 468 8.0E-159
sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 16 467 7.0E-158
sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 16 467 1.0E-157
sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=1 SV=1 3 468 3.0E-157
sp|Q42290|MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=2 SV=2 32 464 4.0E-154
sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=2 32 467 5.0E-137
sp|Q68FY0|QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1 32 467 7.0E-135
sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3 33 467 2.0E-134
sp|P31800|QCR1_BOVIN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2 25 467 5.0E-131
sp|Q4W6B5|MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum GN=mppB PE=1 SV=1 36 464 1.0E-129
sp|P43264|QCR1_EUGGR Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1 36 441 3.0E-101
sp|P07256|QCR1_YEAST Cytochrome b-c1 complex subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COR1 PE=1 SV=1 23 467 2.0E-79
sp|P98080|UCR1_CAEEL Cytochrome b-c1 complex subunit 1, mitochondrial OS=Caenorhabditis elegans GN=ucr-1 PE=3 SV=2 3 467 1.0E-77
sp|Q4UML9|Y338_RICFE Uncharacterized zinc protease RF_0338 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0338 PE=3 SV=1 39 439 2.0E-57
sp|Q9DC61|MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus GN=Pmpca PE=1 SV=1 36 467 4.0E-55
sp|Q1RJ61|Y522_RICBR Uncharacterized zinc protease RBE_0522 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0522 PE=3 SV=1 38 439 2.0E-53
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 32 441 3.0E-53
sp|Q92IX7|Y293_RICCN Uncharacterized zinc protease RC0293 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0293 PE=3 SV=1 38 439 4.0E-53
sp|Q5R513|MPPA_PONAB Mitochondrial-processing peptidase subunit alpha OS=Pongo abelii GN=PMPCA PE=2 SV=2 36 470 1.0E-52
sp|Q10713|MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens GN=PMPCA PE=1 SV=2 36 470 2.0E-52
sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 36 470 4.0E-52
sp|O05945|Y219_RICPR Uncharacterized zinc protease RP219 OS=Rickettsia prowazekii (strain Madrid E) GN=RP219 PE=3 SV=1 41 452 1.0E-51
sp|Q0P5M8|MPPA_BOVIN Mitochondrial-processing peptidase subunit alpha OS=Bos taurus GN=PMPCA PE=2 SV=1 36 467 4.0E-51
sp|Q68XF0|Y210_RICTY Uncharacterized zinc protease RT0210 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0210 PE=3 SV=1 39 452 6.0E-51
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 33 455 3.0E-50
sp|P20069|MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus GN=Pmpca PE=1 SV=1 36 467 7.0E-50
sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 37 460 5.0E-48
sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=2 SV=1 37 471 7.0E-48
sp|O32965|Y855_MYCLE Uncharacterized zinc protease ML0855 OS=Mycobacterium leprae (strain TN) GN=ML0855 PE=3 SV=1 39 452 5.0E-44
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 22 437 5.0E-44
sp|P0A5S9|Y2805_MYCBO Uncharacterized zinc protease Mb2805c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2805c PE=3 SV=1 39 452 5.0E-44
sp|P9WHT5|Y2782_MYCTU Uncharacterized zinc protease Rv2782c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2782c PE=1 SV=1 39 452 5.0E-44
sp|Q04805|YMXG_BACSU Uncharacterized zinc protease YmxG OS=Bacillus subtilis (strain 168) GN=ymxG PE=3 SV=3 40 451 5.0E-44
sp|P9WHT4|Y2782_MYCTO Uncharacterized zinc protease MT2852 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2852 PE=3 SV=1 39 452 1.0E-42
sp|P97997|MPPA_BLAEM Mitochondrial-processing peptidase subunit alpha OS=Blastocladiella emersonii PE=3 SV=1 35 452 8.0E-42
sp|Q54F93|MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum GN=mppA2 PE=1 SV=1 37 468 4.0E-38
sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 39 454 1.0E-34
sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 39 454 2.0E-33
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 39 242 5.0E-32
sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 39 454 2.0E-31
sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 39 454 4.0E-30
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 41 411 9.0E-22
sp|Q5UPX9|YL233_MIMIV Putative zinc protease L233 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L233 PE=3 SV=1 37 225 2.0E-21
sp|Q86A84|MPPA1_DICDI Mitochondrial-processing peptidase subunit alpha-1 OS=Dictyostelium discoideum GN=mppA1 PE=1 SV=1 37 243 3.0E-15
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 277 439 1.0E-13
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 38 457 3.0E-13
sp|P55174|PQQF_PSEPH Coenzyme PQQ synthesis protein F OS=Pseudomonas protegens (strain DSM 19095 / CHA0) GN=pqqF PE=3 SV=1 45 243 1.0E-11
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 34 251 3.0E-11
sp|Q9I2D2|PQQF_PSEAE Coenzyme PQQ synthesis protein F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqqF PE=3 SV=1 36 247 4.0E-11
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 57 457 6.0E-11
sp|Q8X6M8|PTRA_ECO57 Protease 3 OS=Escherichia coli O157:H7 GN=ptrA PE=3 SV=1 37 262 1.0E-09
sp|P05458|PTRA_ECOLI Protease 3 OS=Escherichia coli (strain K12) GN=ptrA PE=1 SV=1 37 262 1.0E-09
sp|Q8CVS2|PTRA_ECOL6 Protease 3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ptrA PE=3 SV=1 37 262 1.0E-09
sp|Q83QC3|PTRA_SHIFL Protease 3 OS=Shigella flexneri GN=ptrA PE=3 SV=1 37 262 1.0E-09
sp|Q54JQ2|IDE_DICDI Insulin-degrading enzyme homolog OS=Dictyostelium discoideum GN=DDB_G0287851 PE=3 SV=1 27 245 8.0E-09
sp|P45181|PQQL_HAEIN Probable zinc protease PqqL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pqqL PE=3 SV=1 60 240 1.0E-08
sp|Q88QV3|PQQF_PSEPK Coenzyme PQQ synthesis protein F OS=Pseudomonas putida (strain KT2440) GN=pqqF PE=3 SV=1 40 238 2.0E-08
sp|P31828|PQQL_ECOLI Probable zinc protease PqqL OS=Escherichia coli (strain K12) GN=pqqL PE=3 SV=2 60 252 3.0E-08
sp|Q88A79|PQQF_PSESM Coenzyme PQQ synthesis protein F OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pqqF PE=3 SV=1 40 157 9.0E-08
sp|P07257|QCR2_YEAST Cytochrome b-c1 complex subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR2 PE=1 SV=1 45 349 3.0E-07
sp|O31766|YMFH_BACSU Uncharacterized zinc protease YmfH OS=Bacillus subtilis (strain 168) GN=ymfH PE=3 SV=2 63 243 4.0E-07
sp|Q6CWJ6|QCR2_KLULA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR2 PE=3 SV=1 56 349 6.0E-07
sp|Q8ZMB5|PTRA_SALTY Protease 3 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ptrA PE=3 SV=1 37 262 6.0E-07
sp|P42789|SDP_EIMBO Sporozoite developmental protein OS=Eimeria bovis PE=2 SV=1 41 137 9.0E-07
sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE PE=2 SV=1 41 246 3.0E-06
sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 56 224 7.0E-06
sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide PE=1 SV=1 41 246 7.0E-06
sp|Q8Z418|PTRA_SALTI Protease 3 OS=Salmonella typhi GN=ptrA PE=3 SV=1 37 262 8.0E-06
sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=IDE PE=1 SV=4 41 246 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup949
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|763 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4384
Ophiocordyceps camponoti-floridani Ophcf2|02276
Ophiocordyceps camponoti-rufipedis Ophun1|3179
Ophiocordyceps kimflemingae Ophio5|5103
Ophiocordyceps subramaniannii Hirsu2|7047

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|763
MASQRLSLKLSQSLRGRSGLYGLRRGLATPTSVGTTQTTTLKNGLTVATEHSPWAQTSTVGMWIDAGSRAETDET
NGTAHFLEHLAFKGTARRSQQQLELEIENMGAHLNAYTSRENTVYFAKAFNSDVPQCVDVLSDILQNSKLEESAI
ERERDVILRESEEVEKQIEEVVFDHLHATAFQRQPLGRTILGPRQNIRDITRTELANYIKNNYTADRMVLVGAGG
VPHEKLVELAEKNFGNVPGKGPENHAYLLSKAQADFIGSDVRVRDDTMPTAHIALAVEGVSWSSDDYFTAMVAQA
IVGNYDKATGSAPNQGSKLSGFVHKYELANSFMSFSTSYSDTGLWGIYLVTDKVNQIDDLVHFSIREWMRLCSNV
GESETERAKAQLKASILLSLDGTTAVAEDIGRQLITTGRRMMPGELERRIDAVTEKDVMEFATRKLWDKELAISA
IGSIEGLFDYQRLRNTMKPKF*
Coding >OphauG2|763
ATGGCGTCTCAAAGGCTATCCTTGAAGCTCTCGCAGAGCCTGCGAGGCCGCTCTGGTCTGTATGGCCTGCGACGC
GGATTGGCGACACCCACGAGTGTTGGTACAACTCAGACGACGACGCTCAAGAATGGATTGACAGTTGCTACGGAG
CACTCCCCTTGGGCGCAAACATCAACCGTCGGCATGTGGATCGATGCCGGTTCGCGGGCCGAAACGGACGAGACG
AATGGCACCGCGCACTTCCTCGAGCATCTGGCCTTCAAGGGGACGGCGAGACGATCTCAACAGCAGCTGGAACTT
GAGATTGAGAACATGGGCGCCCACCTGAATGCCTACACCTCGCGAGAAAACACAGTCTATTTTGCCAAAGCCTTC
AACTCAGACGTTCCTCAGTGCGTCGACGTCCTCTCCGACATCCTGCAAAACTCCAAGCTCGAAGAGTCGGCCATT
GAGCGGGAGCGCGACGTCATTCTGCGAGAATCGGAAGAGGTCGAAAAGCAAATCGAAGAGGTTGTCTTTGACCAC
CTTCATGCCACGGCCTTTCAACGTCAGCCGCTGGGTCGAACCATTCTTGGGCCCCGCCAGAACATCCGTGACATC
ACCCGCACCGAACTTGCTAATTATATAAAGAACAACTACACGGCCGACCGCATGGTGCTTGTAGGCGCTGGCGGT
GTTCCCCACGAGAAGCTTGTCGAGTTGGCCGAGAAGAACTTTGGCAATGTGCCTGGCAAGGGACCCGAGAACCAC
GCCTATCTCCTGTCCAAGGCGCAGGCTGACTTTATCGGATCCGATGTCCGCGTTCGCGATGATACCATGCCCACT
GCCCACATCGCACTGGCTGTTGAGGGCGTCAGCTGGAGCTCAGATGACTACTTTACGGCCATGGTTGCTCAGGCC
ATTGTTGGCAACTATGACAAGGCCACGGGTAGCGCTCCCAACCAGGGAAGCAAGCTCAGCGGCTTCGTTCACAAG
TATGAACTGGCCAACAGCTTCATGAGCTTCTCCACCAGCTATAGTGACACGGGTCTCTGGGGCATCTACCTCGTC
ACGGACAAGGTCAACCAGATCGACGACCTTGTGCATTTCTCGATTCGGGAGTGGATGCGCCTGTGCTCCAATGTG
GGCGAATCCGAGACGGAGCGTGCCAAGGCCCAGCTCAAGGCGTCGATACTCTTGTCGCTTGACGGCACCACGGCC
GTGGCTGAAGACATTGGCCGCCAGCTGATAACGACTGGACGGCGAATGATGCCGGGCGAATTAGAGCGTAGGATT
GATGCTGTCACCGAAAAGGATGTCATGGAATTTGCCACGCGCAAACTGTGGGACAAGGAACTTGCCATCAGCGCT
ATCGGCAGCATCGAAGGCCTCTTTGACTACCAGCGGCTGCGGAACACGATGAAGCCCAAGTTCTAG
Transcript >OphauG2|763
ATGGCGTCTCAAAGGCTATCCTTGAAGCTCTCGCAGAGCCTGCGAGGCCGCTCTGGTCTGTATGGCCTGCGACGC
GGATTGGCGACACCCACGAGTGTTGGTACAACTCAGACGACGACGCTCAAGAATGGATTGACAGTTGCTACGGAG
CACTCCCCTTGGGCGCAAACATCAACCGTCGGCATGTGGATCGATGCCGGTTCGCGGGCCGAAACGGACGAGACG
AATGGCACCGCGCACTTCCTCGAGCATCTGGCCTTCAAGGGGACGGCGAGACGATCTCAACAGCAGCTGGAACTT
GAGATTGAGAACATGGGCGCCCACCTGAATGCCTACACCTCGCGAGAAAACACAGTCTATTTTGCCAAAGCCTTC
AACTCAGACGTTCCTCAGTGCGTCGACGTCCTCTCCGACATCCTGCAAAACTCCAAGCTCGAAGAGTCGGCCATT
GAGCGGGAGCGCGACGTCATTCTGCGAGAATCGGAAGAGGTCGAAAAGCAAATCGAAGAGGTTGTCTTTGACCAC
CTTCATGCCACGGCCTTTCAACGTCAGCCGCTGGGTCGAACCATTCTTGGGCCCCGCCAGAACATCCGTGACATC
ACCCGCACCGAACTTGCTAATTATATAAAGAACAACTACACGGCCGACCGCATGGTGCTTGTAGGCGCTGGCGGT
GTTCCCCACGAGAAGCTTGTCGAGTTGGCCGAGAAGAACTTTGGCAATGTGCCTGGCAAGGGACCCGAGAACCAC
GCCTATCTCCTGTCCAAGGCGCAGGCTGACTTTATCGGATCCGATGTCCGCGTTCGCGATGATACCATGCCCACT
GCCCACATCGCACTGGCTGTTGAGGGCGTCAGCTGGAGCTCAGATGACTACTTTACGGCCATGGTTGCTCAGGCC
ATTGTTGGCAACTATGACAAGGCCACGGGTAGCGCTCCCAACCAGGGAAGCAAGCTCAGCGGCTTCGTTCACAAG
TATGAACTGGCCAACAGCTTCATGAGCTTCTCCACCAGCTATAGTGACACGGGTCTCTGGGGCATCTACCTCGTC
ACGGACAAGGTCAACCAGATCGACGACCTTGTGCATTTCTCGATTCGGGAGTGGATGCGCCTGTGCTCCAATGTG
GGCGAATCCGAGACGGAGCGTGCCAAGGCCCAGCTCAAGGCGTCGATACTCTTGTCGCTTGACGGCACCACGGCC
GTGGCTGAAGACATTGGCCGCCAGCTGATAACGACTGGACGGCGAATGATGCCGGGCGAATTAGAGCGTAGGATT
GATGCTGTCACCGAAAAGGATGTCATGGAATTTGCCACGCGCAAACTGTGGGACAAGGAACTTGCCATCAGCGCT
ATCGGCAGCATCGAAGGCCTCTTTGACTACCAGCGGCTGCGGAACACGATGAAGCCCAAGTTCTAG
Gene >OphauG2|763
ATGGCGTCTCAAAGGCTATCCTTGAAGCTCTCGCAGAGCCTGCGAGGCCGCTCTGGTCTGTATGGCCTGCGACGC
GGATTGGCGACACCCACGAGTGTTGGTACAACTCAGACGACGACGCTCAAGAATGGATTGACAGTACGCATCAGT
TTGACCTTGGCCGCCTTGCTGTCGTGTCAATGGGCTTCTGACATGCATCCCAGGTTGCTACGGAGCACTCCCCTT
GGGCGCAAACATCAACCGTCGGCATGTGGATCGATGCCGGTTCGCGGGCCGAAACGGACGAGACGAATGGCACCG
CGCACTTCCTCGAGCATCTGGCCTTCAAGGTAAGGCACCACGGCGGACGTGATGGCATGGTCCCAGATGCTGATG
CTCAAGTAAAGGGGACGGCGAGACGATCTCAACAGCAGCTGGAACTTGAGATTGAGAACATGGGCGCCCACCTGA
ATGCCTACACCTCGGTAAGACGACGCTTGGGCGGCATGTGAGCAACCTGGCCCCGGCTGGTCTGACGAGCATACA
GCGAGAAAACACAGTCTATTTTGCCAAAGCCTTCAACTCAGACGTTCCTCAGTGCGTCGACGTCCTCTCCGACAT
CCTGCAAAACTCCAAGCTCGAAGAGTCGGCCATTGAGCGGGAGCGCGACGTCATTCTGCGAGAATCGGAAGAGGT
CGAAAAGCAAATCGAAGAGGTTGTCTTTGACCACCTTCATGCCACGGCCTTTCAACGTCAGCCGCTGGGTCGAAC
CATTCTTGGGCCCCGCCAGAACATCCGTGACATCACCCGCACCGAACTTGCTAATTATATAAAGAACAACTACAC
GGCCGACCGCATGGTGCTTGTAGGCGCTGGCGGTGTTCCCCACGAGAAGCTTGTCGAGTTGGCCGAGAAGAACTT
TGGCAATGTGCCTGGCAAGGGACCCGAGAACCACGCCTATCTCCTGTCCAAGGCGCAGGCTGACTTTATCGGATC
CGATGTCCGCGTTCGCGATGATACCATGCCCACTGCCCACATCGCACTGGCTGTTGAGGGCGTCAGCTGGAGCTC
AGATGACTACTTTACGGCCATGGTTGCTCAGGCCATTGTTGGCAACTATGACAAGGCCACGGGTAGCGCTCCCAA
CCAGGGAAGCAAGCTCAGCGGCTTCGTTCACAAGTATGAACTGGCCAACAGCTTCATGAGCTTCTCCACCAGCTA
TAGTGACACGGGGTAAGTCGAAGCTTGTCTGTTTGTTGCTACGCATCAAGTGTGCTGAGACAGTGTAGTCTCTGG
GGCATCTACCTCGTCACGGACAAGGTCAACCAGATCGACGACCTTGTGCATTTCTCGATTCGGGAGTGGATGCGC
CTGTGCTCCAATGTGGGCGAATCCGAGACGGAGCGTGCCAAGGCCCAGCTCAAGGCGTCGATACTCTTGTCGCTT
GACGGCACCACGGCCGTGGCTGAAGACATTGGCCGCCAGCTGATAACGACTGGACGGCGAATGATGCCGGGCGAA
TTAGAGCGTAGGATTGATGCTGTCACCGAAAAGGATGTCATGGAATTTGCCACGCGCAAACTGTGGGACAAGGAA
CTTGCCATCAGCGCTATCGGCAGCATCGAAGGCCTCTTTGACTACCAGCGGCTGCGGAACACGATGAAGCCCAAG
TTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail