Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7625
Gene name
LocationContig_905:3389..4331
Strand+
Gene length (bp)942
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 1.2E-24 33 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40961|PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB1 PE=1 SV=2 14 265 1.0E-132
sp|Q9P7H3|PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb1 PE=3 SV=1 9 276 4.0E-128
sp|P24156|L2CC_DROME Protein l(2)37Cc OS=Drosophila melanogaster GN=l(2)37Cc PE=2 SV=2 29 268 3.0E-107
sp|O04331|PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana GN=PHB3 PE=1 SV=1 14 277 1.0E-105
sp|Q54GI9|PHB1_DICDI Prohibitin-1, mitochondrial OS=Dictyostelium discoideum GN=phbA PE=3 SV=1 15 268 2.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40961|PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB1 PE=1 SV=2 14 265 1.0E-132
sp|Q9P7H3|PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb1 PE=3 SV=1 9 276 4.0E-128
sp|P24156|L2CC_DROME Protein l(2)37Cc OS=Drosophila melanogaster GN=l(2)37Cc PE=2 SV=2 29 268 3.0E-107
sp|O04331|PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana GN=PHB3 PE=1 SV=1 14 277 1.0E-105
sp|Q54GI9|PHB1_DICDI Prohibitin-1, mitochondrial OS=Dictyostelium discoideum GN=phbA PE=3 SV=1 15 268 2.0E-105
sp|P84173|PHB_CHICK Prohibitin OS=Gallus gallus GN=PHB PE=1 SV=1 27 268 9.0E-104
sp|P67779|PHB_RAT Prohibitin OS=Rattus norvegicus GN=Phb PE=1 SV=1 27 264 3.0E-103
sp|P67778|PHB_MOUSE Prohibitin OS=Mus musculus GN=Phb PE=1 SV=1 27 264 3.0E-103
sp|P35232|PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 27 264 1.0E-102
sp|Q3T165|PHB_BOVIN Prohibitin OS=Bos taurus GN=PHB PE=2 SV=1 27 264 1.0E-102
sp|Q9BKU4|PHB1_CAEEL Mitochondrial prohibitin complex protein 1 OS=Caenorhabditis elegans GN=phb-1 PE=1 SV=1 22 267 6.0E-102
sp|Q9LK25|PHB4_ARATH Prohibitin-4, mitochondrial OS=Arabidopsis thaliana GN=PHB4 PE=1 SV=1 14 277 1.0E-101
sp|O49460|PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana GN=PHB1 PE=1 SV=1 26 262 3.0E-97
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 27 262 8.0E-96
sp|Q9SIL6|PHB6_ARATH Prohibitin-6, mitochondrial OS=Arabidopsis thaliana GN=PHB6 PE=1 SV=1 24 262 1.0E-95
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 27 265 4.0E-95
sp|Q54Q31|PHB2_DICDI Prohibitin-2 OS=Dictyostelium discoideum GN=phbB PE=3 SV=1 29 265 2.0E-93
sp|Q9FFH5|PHB7_ARATH Prohibitin-7, mitochondrial OS=Arabidopsis thaliana GN=PHB7 PE=1 SV=1 24 266 4.0E-92
sp|O35129|PHB2_MOUSE Prohibitin-2 OS=Mus musculus GN=Phb2 PE=1 SV=1 7 263 5.0E-91
sp|Q99623|PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 7 263 5.0E-91
sp|Q5XIH7|PHB2_RAT Prohibitin-2 OS=Rattus norvegicus GN=Phb2 PE=1 SV=1 7 263 5.0E-91
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 25 263 8.0E-91
sp|Q5RB19|PHB2_PONAB Prohibitin-2 OS=Pongo abelii GN=PHB2 PE=2 SV=1 7 268 1.0E-90
sp|A9UMS3|PHB2_XENTR Prohibitin-2 OS=Xenopus tropicalis GN=phb2 PE=2 SV=1 7 263 1.0E-90
sp|Q2HJ97|PHB2_BOVIN Prohibitin-2 OS=Bos taurus GN=PHB2 PE=2 SV=1 7 263 4.0E-90
sp|Q5ZMN3|PHB2_CHICK Prohibitin-2 OS=Gallus gallus GN=PHB2 PE=2 SV=1 28 263 3.0E-85
sp|Q9LY99|PHB5_ARATH Prohibitin-5, mitochondrial OS=Arabidopsis thaliana GN=PHB5 PE=3 SV=1 29 268 6.0E-80
sp|P50093|PHB2_CAEEL Mitochondrial prohibitin complex protein 2 OS=Caenorhabditis elegans GN=phb-2 PE=1 SV=2 28 264 4.0E-79
sp|P86220|PHB_MESAU Prohibitin (Fragments) OS=Mesocricetus auratus GN=PHB PE=1 SV=1 87 200 4.0E-16
sp|O28852|Y1420_ARCFU Uncharacterized protein AF_1420 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1420 PE=3 SV=1 33 251 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup157
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5450
Ophiocordyceps australis 1348a (Ghana) OphauG2|7625 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3014
Ophiocordyceps australis map64 (Brazil) OphauB2|5252
Ophiocordyceps camponoti-floridani Ophcf2|01279
Ophiocordyceps camponoti-floridani Ophcf2|07325
Ophiocordyceps camponoti-rufipedis Ophun1|2335
Ophiocordyceps camponoti-rufipedis Ophun1|4433
Ophiocordyceps kimflemingae Ophio5|1059
Ophiocordyceps kimflemingae Ophio5|8368
Ophiocordyceps subramaniannii Hirsu2|11089
Ophiocordyceps subramaniannii Hirsu2|2047

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7625
MAQHTSRGLQWAYRMAFPATAAAFFASQSIFDVKGGSRAVIFDRLSGVRENVIGEGTHFLIPWLQRSIQFDVRTK
PRNIATTTGSKDLQMVSLTLRVLHRPMVKELPKIYQNLGVDYAERVLPSIGNEVLKAIVAQFDAAELITQREAVS
QRIRNDLTLRAAEFNIALEDVSITHMTFGREFTKAVEQKQIAQQDAERARFIVERAEQERQANVIRAEGEAESAD
TIGKAIAKSGDGLIQIRKIEASREIAQTLSSNPNVTYLPNSKNGSGGGQYLLSVGRG*
Coding >OphauG2|7625
ATGGCCCAGCATACTTCACGGGGGCTCCAATGGGCCTATCGAATGGCGTTTCCCGCAACCGCGGCAGCTTTCTTC
GCCTCGCAATCCATCTTCGACGTCAAGGGTGGCTCGCGAGCCGTCATTTTTGACCGCTTGAGCGGAGTCAGGGAG
AATGTAATTGGCGAAGGCACTCATTTCCTCATTCCTTGGCTGCAGCGAAGTATCCAGTTTGATGTGCGCACCAAG
CCGCGCAACATTGCTACGACGACTGGCTCCAAGGACTTGCAAATGGTCAGCCTGACGTTGCGAGTTTTGCATCGG
CCCATGGTCAAAGAGCTACCCAAAATCTACCAAAATCTCGGCGTCGACTATGCAGAGCGTGTTCTCCCCTCGATT
GGCAACGAAGTTTTGAAAGCCATCGTCGCCCAATTTGACGCTGCAGAGCTCATCACCCAGCGCGAGGCCGTCTCG
CAGCGTATCCGAAACGACCTCACCCTTCGCGCAGCCGAGTTCAATATTGCCCTCGAGGACGTGTCCATTACTCAC
ATGACCTTTGGCCGTGAATTTACAAAGGCTGTTGAGCAGAAGCAAATTGCCCAGCAAGACGCTGAGCGCGCCCGC
TTCATTGTCGAGCGCGCAGAACAGGAGCGGCAGGCCAACGTTATCCGTGCCGAGGGTGAAGCTGAAAGCGCAGAC
ACCATCGGTAAAGCGATTGCAAAGTCGGGCGATGGCTTGATTCAGATTCGCAAAATTGAGGCATCAAGAGAAATT
GCACAGACCCTCTCCTCTAACCCCAATGTTACCTATCTGCCCAACAGCAAGAACGGCTCTGGTGGTGGCCAATAT
CTCCTCTCAGTCGGACGAGGTTGA
Transcript >OphauG2|7625
ATGGCCCAGCATACTTCACGGGGGCTCCAATGGGCCTATCGAATGGCGTTTCCCGCAACCGCGGCAGCTTTCTTC
GCCTCGCAATCCATCTTCGACGTCAAGGGTGGCTCGCGAGCCGTCATTTTTGACCGCTTGAGCGGAGTCAGGGAG
AATGTAATTGGCGAAGGCACTCATTTCCTCATTCCTTGGCTGCAGCGAAGTATCCAGTTTGATGTGCGCACCAAG
CCGCGCAACATTGCTACGACGACTGGCTCCAAGGACTTGCAAATGGTCAGCCTGACGTTGCGAGTTTTGCATCGG
CCCATGGTCAAAGAGCTACCCAAAATCTACCAAAATCTCGGCGTCGACTATGCAGAGCGTGTTCTCCCCTCGATT
GGCAACGAAGTTTTGAAAGCCATCGTCGCCCAATTTGACGCTGCAGAGCTCATCACCCAGCGCGAGGCCGTCTCG
CAGCGTATCCGAAACGACCTCACCCTTCGCGCAGCCGAGTTCAATATTGCCCTCGAGGACGTGTCCATTACTCAC
ATGACCTTTGGCCGTGAATTTACAAAGGCTGTTGAGCAGAAGCAAATTGCCCAGCAAGACGCTGAGCGCGCCCGC
TTCATTGTCGAGCGCGCAGAACAGGAGCGGCAGGCCAACGTTATCCGTGCCGAGGGTGAAGCTGAAAGCGCAGAC
ACCATCGGTAAAGCGATTGCAAAGTCGGGCGATGGCTTGATTCAGATTCGCAAAATTGAGGCATCAAGAGAAATT
GCACAGACCCTCTCCTCTAACCCCAATGTTACCTATCTGCCCAACAGCAAGAACGGCTCTGGTGGTGGCCAATAT
CTCCTCTCAGTCGGACGAGGTTGA
Gene >OphauG2|7625
ATGGCCCAGCATACTTCACGGGGGCTCCAATGGGCCTATCGAATGGCGTTTCCCGCAACCGCGGCAGCTTTCTTC
GCCTCGCAATCCATCTTCGACGTCAAGGGTGGCTCGCGAGCCGTCATTTTTGACCGCTTGAGCGGAGTCAGGGAG
AATGTAATTGGCGAAGGCACTCATTTCCTCATTCCTTGGCTGCAGCGAAGTATCCAGTTTGATGTGCGCACCAAG
CCGCGCAACATTGCTACGACGACTGGCTCCAAGGACTTGCAAATGGTCAGCCTGACGTTGCGAGTTTTGCATCGG
CCCATGGTCAAAGAGCTACCCAAAATCTACCAAGTCAGTCTTGCCCATATATTTACCAAAGAACATTAGCAAGGT
CTTCAAAGGCGTCGGTCCGCTATACCATGATGAAGAGCTGACTAGGAGTAGAATCTCGGCGTCGACTATGCAGAG
CGTGTTCTCCCCTCGATTGGCAACGAAGTTTTGAAAGCCATCGTCGCCCAATTTGACGCTGCAGAGCTCATCACC
CAGCGCGAGGCCGTCTCGCAGCGTATCCGAAACGACCTCACCCTTCGCGCAGCCGAGTTCAATATTGCCCTCGAG
GACGTGTCCATTACTCACATGACCTTTGGCCGTGAATTTACAAAGGCTGTTGAGCAGAAGCAAATTGCCCAGCAA
GACGCTGAGCGCGCCCGCTTCATTGTCGAGCGCGCAGAACAGGAGCGGCAGGCCAACGTTATCCGTGCCGAGGGT
GAAGCTGAAAGCGCAGACACCATCGGTAAAGCGATTGCAAAGTCGGGCGATGGCTTGATTCAGATTCGCAAAATT
GAGGCATCAAGAGAAATTGCACAGACCCTCTCCTCTAACCCCAATGTTACCTATCTGCCCAACAGCAAGAACGGC
TCTGGTGGTGGCCAATATCTCCTCTCAGTCGGACGAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail