Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7610
Gene name
LocationContig_901:2388..5020
Strand-
Gene length (bp)2632
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 1.8E-193 35 728
PF10557 Cullin_Nedd8 Cullin protein neddylation domain 3.9E-24 763 823

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul3 PE=1 SV=2 14 834 3.0E-155
sp|Q6DE95|CUL3A_XENLA Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1 35 834 1.0E-149
sp|A4IHP4|CUL3_XENTR Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1 35 834 4.0E-149
sp|Q6GPF3|CUL3B_XENLA Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1 35 834 4.0E-149
sp|B5DF89|CUL3_RAT Cullin-3 OS=Rattus norvegicus GN=Cul3 PE=1 SV=2 35 834 2.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul3 PE=1 SV=2 14 834 3.0E-155
sp|Q6DE95|CUL3A_XENLA Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1 35 834 1.0E-149
sp|A4IHP4|CUL3_XENTR Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1 35 834 4.0E-149
sp|Q6GPF3|CUL3B_XENLA Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1 35 834 4.0E-149
sp|B5DF89|CUL3_RAT Cullin-3 OS=Rattus norvegicus GN=Cul3 PE=1 SV=2 35 834 2.0E-148
sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 35 834 2.0E-148
sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 35 834 9.0E-148
sp|Q9ZVH4|CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana GN=CUL3A PE=1 SV=1 32 834 4.0E-144
sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=culC PE=3 SV=1 35 834 4.0E-143
sp|Q9C9L0|CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana GN=CUL3B PE=1 SV=1 32 834 4.0E-140
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 11 834 4.0E-116
sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3 PE=1 SV=2 2 834 8.0E-116
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=1 SV=1 6 834 3.0E-112
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=4 32 834 7.0E-107
sp|A2A432|CUL4B_MOUSE Cullin-4B OS=Mus musculus GN=Cul4b PE=1 SV=1 32 834 5.0E-106
sp|Q8LGH4|CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana GN=CUL4 PE=1 SV=1 16 834 3.0E-100
sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1 SV=1 30 834 1.0E-96
sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=culD PE=3 SV=1 15 834 7.0E-95
sp|Q9SRZ0|CUL2_ARATH Cullin-2 OS=Arabidopsis thaliana GN=CUL2 PE=1 SV=1 117 834 2.0E-77
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=culA PE=1 SV=1 132 834 1.0E-73
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster GN=Cul1 PE=1 SV=2 10 834 7.0E-73
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 122 834 5.0E-71
sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1 122 834 5.0E-71
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 122 834 5.0E-71
sp|P0CH31|CLL1_ARATH Putative cullin-like protein 1 OS=Arabidopsis thaliana GN=At1g43140 PE=3 SV=1 31 834 4.0E-63
sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2 190 834 1.0E-60
sp|Q5RCF3|CUL2_PONAB Cullin-2 OS=Pongo abelii GN=CUL2 PE=2 SV=1 191 834 1.0E-59
sp|Q13617|CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2 191 834 1.0E-59
sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1 PE=1 SV=1 120 834 2.0E-58
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul1 PE=1 SV=1 237 820 7.0E-56
sp|Q54XF7|CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum GN=culE PE=3 SV=1 50 834 4.0E-55
sp|Q17390|CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans GN=cul-2 PE=1 SV=3 232 834 2.0E-52
sp|Q17392|CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans GN=cul-4 PE=1 SV=3 35 834 1.0E-51
sp|Q9XZJ3|CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum GN=culB PE=2 SV=1 200 834 1.0E-49
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul4 PE=1 SV=1 132 834 1.0E-48
sp|Q21346|CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans GN=cul-6 PE=1 SV=1 120 834 2.0E-48
sp|Q12018|CDC53_YEAST Cell division control protein 53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC53 PE=1 SV=1 190 834 1.0E-44
sp|P53202|CUL3_YEAST Cullin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUL3 PE=1 SV=1 41 834 1.0E-43
sp|Q5RB36|CUL5_PONAB Cullin-5 OS=Pongo abelii GN=CUL5 PE=2 SV=3 200 834 9.0E-37
sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens GN=CUL5 PE=1 SV=4 200 834 4.0E-36
sp|Q9JJ31|CUL5_RAT Cullin-5 OS=Rattus norvegicus GN=Cul5 PE=1 SV=3 200 834 2.0E-35
sp|Q23639|CUL5_CAEEL Cullin-5 OS=Caenorhabditis elegans GN=cul-5 PE=1 SV=2 184 820 3.0E-35
sp|Q9D5V5|CUL5_MOUSE Cullin-5 OS=Mus musculus GN=Cul5 PE=1 SV=3 200 834 4.0E-35
sp|Q29425|CUL5_RABIT Cullin-5 OS=Oryctolagus cuniculus GN=CUL5 PE=2 SV=3 200 834 1.0E-34
sp|Q9XIE9|CLL2_ARATH Putative cullin-like protein 2 OS=Arabidopsis thaliana GN=At1g59790 PE=3 SV=2 57 377 8.0E-08
sp|Q9XIE8|CLL3_ARATH Cullin-like protein 3 OS=Arabidopsis thaliana GN=At1g59800 PE=3 SV=2 58 299 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0043170 macromolecule metabolic process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0019899 enzyme binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2267
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7610 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1697
Ophiocordyceps camponoti-floridani Ophcf2|00163
Ophiocordyceps camponoti-rufipedis Ophun1|6734
Ophiocordyceps kimflemingae Ophio5|642
Ophiocordyceps subramaniannii Hirsu2|2960

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7610
MISGRGGAGGRSGRIRPPRRFVRRSDDMTDLEECWKMLEEALGDIHRKSCGQLSFEQLYRSAYKMVVKKKGDVLY
DRVQQFEEKWFADHVIPTIDLLITKSLANIGADHSAGSANERRQTGERFLRGMRDIWQDHNMSMNMTADILMYLD
RGYTLLEPKRIPIFAATIGLFRDHILQSCLSENSEQLVLDIIVSVMLDQINMEREGDVIDRNLIRSCSRMLGCLY
VSVYETESQTLYKTIFEERFLQHSRKFYVKECQQLIRDADPRAWLRHTQRRINEETERCDHTIELRTLPRIIRVV
EQTLISDHLQEFMTMEPNGFKWMIDNDRTEDLSILYNLSARIDKDKTALRAMLQKRVVELGSEIQNVLKNTDFST
SGSAEGGEEGEKNKTLSPAAQQTAAAIKWVDDVLLLRAKFDSLLSECFGDDVIIQSALTKSFSDFINAFDRSAEY
VSLYMDDNFKRGIRGMTETEVDASLEKAIVLLRYLQDKDLLQTYYQRHLARRLLHGKSESHDAERQILSRMKQEL
GQQFTSKFEGMFRDLSASEDLTSGYRHYMSKLGDSPSIELNVNVLTTNYWPHEIMGRQASIGEGSRISCTYPRQI
KTLQASFGQYYLTDRSGRKLTWVGTMGSADIKCTFPAIAGKSGALGRERRYDIIVPTFAMVVMLLFNDLDVDQGL
SFDEIQARTGITPQDLMRTLTAIAVAPKSRVLLKEPASKMVKTSDKFYFNASFQSKTVRIKAPVINAVSKVEDKE
DRQATEDKNLQTRSHIIDAAVVRIMKSRKELGHTQLVSEVMGQLSSRFKPEPWLIKKRIEDLIVREYLERPDEEG
APSMYRYVA*
Coding >OphauG2|7610
ATGATCTCTGGGCGAGGCGGCGCGGGTGGCCGTAGCGGCCGCATTCGCCCGCCTCGTCGCTTCGTACGCCGCAGT
GACGACATGACAGACCTGGAAGAATGCTGGAAGATGCTGGAAGAGGCCCTGGGCGATATCCACCGCAAGAGCTGC
GGACAATTGTCCTTTGAACAACTCTACAGGTCGGCCTATAAAATGGTGGTCAAAAAGAAGGGAGATGTTCTCTAT
GACCGGGTCCAGCAGTTTGAGGAGAAGTGGTTCGCGGACCATGTCATTCCAACCATTGACTTATTGATAACCAAA
AGCCTCGCCAACATTGGCGCCGACCACTCAGCCGGCTCCGCTAACGAGAGACGACAAACGGGAGAAAGGTTTCTT
AGAGGGATGCGAGACATATGGCAAGATCATAACATGTCGATGAATATGACGGCCGACATTCTCATGTATCTCGAC
CGTGGGTACACGCTACTGGAGCCCAAGCGCATCCCCATATTTGCTGCCACGATTGGTCTCTTTCGCGATCACATT
CTTCAGTCCTGCCTCAGCGAGAATTCCGAGCAGCTTGTGCTCGACATTATCGTATCCGTCATGCTAGACCAGATC
AACATGGAACGCGAGGGCGACGTCATTGACAGGAATCTGATTCGCAGTTGCAGCCGCATGCTGGGCTGTCTCTAT
GTATCAGTGTATGAGACGGAATCCCAAACGCTTTACAAGACCATCTTTGAGGAGCGTTTTTTGCAACACAGCCGC
AAATTCTACGTAAAGGAGTGCCAGCAACTAATTCGCGATGCTGATCCCAGAGCCTGGCTGCGGCACACGCAGAGG
CGCATCAACGAGGAGACGGAGCGATGTGATCACACTATTGAGCTCCGCACGCTGCCCAGGATTATCCGAGTGGTG
GAGCAGACACTGATAAGCGACCATTTGCAAGAGTTTATGACCATGGAGCCAAACGGATTCAAGTGGATGATTGAC
AATGACCGCACCGAGGATCTCAGCATACTCTACAATTTGAGTGCGCGCATTGACAAGGACAAGACTGCGCTACGA
GCCATGCTTCAAAAGCGTGTCGTTGAATTAGGCTCTGAAATCCAAAACGTGCTAAAAAACACCGATTTTTCCACG
TCTGGCTCGGCTGAAGGTGGCGAGGAAGGCGAAAAGAACAAGACGCTGAGTCCGGCCGCACAACAGACTGCGGCC
GCTATCAAATGGGTTGATGACGTGCTACTGCTTAGGGCCAAGTTTGACAGTTTGCTTTCTGAGTGCTTTGGAGAC
GACGTTATTATACAAAGCGCGCTGACCAAGAGCTTCTCCGACTTCATCAATGCCTTTGATCGCAGTGCCGAGTAC
GTGTCTCTCTACATGGACGACAATTTCAAGAGGGGCATCCGCGGCATGACAGAAACCGAAGTGGATGCGTCTTTG
GAGAAAGCCATTGTCCTGTTGCGCTACCTGCAGGATAAGGACCTTCTTCAGACCTACTACCAGCGCCATCTGGCA
CGACGCCTTCTACATGGCAAGTCGGAAAGCCACGACGCCGAGAGACAAATATTGTCGCGCATGAAGCAGGAGCTG
GGCCAGCAATTCACTAGCAAATTCGAGGGCATGTTTCGCGATTTGTCGGCATCTGAGGATCTTACGTCGGGCTAT
CGCCATTACATGAGCAAGCTGGGAGACTCGCCGAGTATCGAGCTCAATGTCAATGTCTTGACGACCAACTACTGG
CCACACGAAATCATGGGGCGTCAAGCATCAATTGGGGAAGGGTCTAGGATCTCGTGCACATACCCGCGCCAAATC
AAGACGCTTCAAGCAAGCTTTGGACAGTATTACCTCACGGACCGTAGCGGGCGAAAGCTGACGTGGGTTGGGACA
ATGGGCAGTGCCGACATCAAGTGCACCTTTCCGGCCATTGCAGGCAAGTCGGGGGCTCTCGGTCGCGAACGACGC
TATGATATAATTGTGCCAACATTTGCCATGGTGGTGATGCTGCTCTTTAACGATTTGGATGTGGACCAGGGCCTG
TCATTTGACGAGATCCAGGCCCGCACAGGCATTACACCCCAGGATCTTATGAGGACCCTGACTGCCATTGCAGTT
GCGCCCAAGTCGCGCGTTCTTTTGAAGGAGCCGGCGTCCAAGATGGTCAAGACGAGCGACAAATTTTACTTCAAC
GCCTCTTTCCAGAGCAAGACTGTACGCATCAAGGCACCCGTCATCAACGCCGTGTCCAAAGTGGAGGACAAGGAA
GACAGACAGGCTACTGAAGACAAGAACCTCCAGACCAGGTCGCATATTATCGACGCGGCCGTTGTGAGAATCATG
AAGTCACGTAAAGAGTTGGGGCATACGCAACTTGTCAGCGAAGTTATGGGGCAGCTGTCATCGCGCTTCAAACCT
GAGCCGTGGCTCATTAAGAAACGCATCGAAGACCTGATTGTACGCGAGTATCTGGAGCGGCCAGACGAAGAAGGG
GCGCCGTCAATGTACCGCTACGTGGCATGA
Transcript >OphauG2|7610
ATGATCTCTGGGCGAGGCGGCGCGGGTGGCCGTAGCGGCCGCATTCGCCCGCCTCGTCGCTTCGTACGCCGCAGT
GACGACATGACAGACCTGGAAGAATGCTGGAAGATGCTGGAAGAGGCCCTGGGCGATATCCACCGCAAGAGCTGC
GGACAATTGTCCTTTGAACAACTCTACAGGTCGGCCTATAAAATGGTGGTCAAAAAGAAGGGAGATGTTCTCTAT
GACCGGGTCCAGCAGTTTGAGGAGAAGTGGTTCGCGGACCATGTCATTCCAACCATTGACTTATTGATAACCAAA
AGCCTCGCCAACATTGGCGCCGACCACTCAGCCGGCTCCGCTAACGAGAGACGACAAACGGGAGAAAGGTTTCTT
AGAGGGATGCGAGACATATGGCAAGATCATAACATGTCGATGAATATGACGGCCGACATTCTCATGTATCTCGAC
CGTGGGTACACGCTACTGGAGCCCAAGCGCATCCCCATATTTGCTGCCACGATTGGTCTCTTTCGCGATCACATT
CTTCAGTCCTGCCTCAGCGAGAATTCCGAGCAGCTTGTGCTCGACATTATCGTATCCGTCATGCTAGACCAGATC
AACATGGAACGCGAGGGCGACGTCATTGACAGGAATCTGATTCGCAGTTGCAGCCGCATGCTGGGCTGTCTCTAT
GTATCAGTGTATGAGACGGAATCCCAAACGCTTTACAAGACCATCTTTGAGGAGCGTTTTTTGCAACACAGCCGC
AAATTCTACGTAAAGGAGTGCCAGCAACTAATTCGCGATGCTGATCCCAGAGCCTGGCTGCGGCACACGCAGAGG
CGCATCAACGAGGAGACGGAGCGATGTGATCACACTATTGAGCTCCGCACGCTGCCCAGGATTATCCGAGTGGTG
GAGCAGACACTGATAAGCGACCATTTGCAAGAGTTTATGACCATGGAGCCAAACGGATTCAAGTGGATGATTGAC
AATGACCGCACCGAGGATCTCAGCATACTCTACAATTTGAGTGCGCGCATTGACAAGGACAAGACTGCGCTACGA
GCCATGCTTCAAAAGCGTGTCGTTGAATTAGGCTCTGAAATCCAAAACGTGCTAAAAAACACCGATTTTTCCACG
TCTGGCTCGGCTGAAGGTGGCGAGGAAGGCGAAAAGAACAAGACGCTGAGTCCGGCCGCACAACAGACTGCGGCC
GCTATCAAATGGGTTGATGACGTGCTACTGCTTAGGGCCAAGTTTGACAGTTTGCTTTCTGAGTGCTTTGGAGAC
GACGTTATTATACAAAGCGCGCTGACCAAGAGCTTCTCCGACTTCATCAATGCCTTTGATCGCAGTGCCGAGTAC
GTGTCTCTCTACATGGACGACAATTTCAAGAGGGGCATCCGCGGCATGACAGAAACCGAAGTGGATGCGTCTTTG
GAGAAAGCCATTGTCCTGTTGCGCTACCTGCAGGATAAGGACCTTCTTCAGACCTACTACCAGCGCCATCTGGCA
CGACGCCTTCTACATGGCAAGTCGGAAAGCCACGACGCCGAGAGACAAATATTGTCGCGCATGAAGCAGGAGCTG
GGCCAGCAATTCACTAGCAAATTCGAGGGCATGTTTCGCGATTTGTCGGCATCTGAGGATCTTACGTCGGGCTAT
CGCCATTACATGAGCAAGCTGGGAGACTCGCCGAGTATCGAGCTCAATGTCAATGTCTTGACGACCAACTACTGG
CCACACGAAATCATGGGGCGTCAAGCATCAATTGGGGAAGGGTCTAGGATCTCGTGCACATACCCGCGCCAAATC
AAGACGCTTCAAGCAAGCTTTGGACAGTATTACCTCACGGACCGTAGCGGGCGAAAGCTGACGTGGGTTGGGACA
ATGGGCAGTGCCGACATCAAGTGCACCTTTCCGGCCATTGCAGGCAAGTCGGGGGCTCTCGGTCGCGAACGACGC
TATGATATAATTGTGCCAACATTTGCCATGGTGGTGATGCTGCTCTTTAACGATTTGGATGTGGACCAGGGCCTG
TCATTTGACGAGATCCAGGCCCGCACAGGCATTACACCCCAGGATCTTATGAGGACCCTGACTGCCATTGCAGTT
GCGCCCAAGTCGCGCGTTCTTTTGAAGGAGCCGGCGTCCAAGATGGTCAAGACGAGCGACAAATTTTACTTCAAC
GCCTCTTTCCAGAGCAAGACTGTACGCATCAAGGCACCCGTCATCAACGCCGTGTCCAAAGTGGAGGACAAGGAA
GACAGACAGGCTACTGAAGACAAGAACCTCCAGACCAGGTCGCATATTATCGACGCGGCCGTTGTGAGAATCATG
AAGTCACGTAAAGAGTTGGGGCATACGCAACTTGTCAGCGAAGTTATGGGGCAGCTGTCATCGCGCTTCAAACCT
GAGCCGTGGCTCATTAAGAAACGCATCGAAGACCTGATTGTACGCGAGTATCTGGAGCGGCCAGACGAAGAAGGG
GCGCCGTCAATGTACCGCTACGTGGCATGA
Gene >OphauG2|7610
ATGATCTCTGGGCGAGGCGGCGCGGGTGGCCGTAGCGGCCGCATTCGCCCGCCTCGTCGCTTCGTACGCGTAAGT
TGTTGTTCTTGACAAATGCCGCCGATATCTAGACTGGCTAACCCAAGTCATGGCCACGGCAGCGCAGTGACGACA
TGACAGACCTGGAAGAATGCTGGAAGATGCTGGAAGAGGCCCTGGGCGATATCCACCGCAAGAGCTGCGGACAAT
TGTCCTTTGAACAACTCTACAGGTCGGCCTATAAAATGGTGGTCAAAAAGAAGGGAGATGTTCTCTATGACCGGG
TCCAGCAGTTTGAGGAGAAGTGGTTCGCGGACCATGTCATTCCAACCATTGACTTATTGATAACCAAAAGCCTCG
CCAACATTGGCGCCGACCACTCAGCCGGCTCCGCTAACGAGAGACGACAAACGGGAGAAAGGTTTCTTAGAGGGA
TGCGAGACATATGGCAAGATCATAACATGTCGATGAATATGACGGCCGACATTCTCATGTATCTCGACCGTGGGT
ACACGCTACTGGAGCCCAAGCGCATCCCCATATTTGCTGCCACGATTGGTCTCTTTCGCGATCACATTCTTCAGT
CCTGCCTCAGCGAGAATTCCGAGCAGCTTGTGCTCGACATTATCGTATCCGTCATGCTAGACCAGATCAACATGG
AACGCGAGGGCGACGTCATTGACAGGAATCTGATTCGCAGTTGCAGCCGCATGCTGGGCTGTCTCTATGTATCAG
TGTATGAGACGGAATCCCAAACGCTTTACAAGACCATCTTTGAGGAGCGTTTTTTGCAACACAGCCGCAAATTCT
ACGTAAAGGAGTGCCAGCAACTAATTCGCGATGCTGATCCCAGAGCCTGGCTGCGGCACACGCAGAGGCGCATCA
ACGAGGAGACGGAGCGATGTGATCACACTATTGAGCTCCGCACGCTGCCCAGGATTATCCGAGTGGTGGAGCAGA
CACTGATAAGCGACCATTTGCAAGAGTTTATGACCATGGAGCCAAACGGATTCAAGTGGATGATTGACAATGACC
GCACCGAGGATCTCAGCATACTCTACAATTTGAGTGCGCGCATTGACAAGGACAAGACTGCGCTACGAGCCATGC
TTCAAAAGCGTGTCGTTGAATTAGGCTCTGAAATCCAAAACGTGCTAAAAAACACCGATTTTTCCACGTCTGGCT
CGGCTGAAGGTGGCGAGGAAGGCGAAAAGAACAAGACGCTGAGTCCGGCCGCACAACAGACTGCGGCCGCTATCA
AATGGGTTGATGACGTGCTACTGCTTAGGGCCAAGTTTGACAGTTTGCTTTCTGAGTGCTTTGGAGACGACGTTA
TTATACAAAGCGCGCTGACCAAGAGCTTCTCCGACTTCATCAATGCCTTTGATCGCAGTGCCGAGTACGTGTCTC
TCTACATGGACGACAATTTCAAGAGGGGCATCCGCGGCATGACAGAAACCGAAGTGGATGCGTCTTTGGAGAAAG
CCATTGTCCTGTTGCGCTACCTGCAGGATAAGGACCTTCTTCAGACCTACTACCAGCGCCATCTGGCACGACGCC
TTCTACATGGCAAGTCGGAAAGCCACGACGCCGAGAGACAAATATTGTCGCGCATGAAGCAGGAGCTGGGCCAGC
AATTCACTAGCAAATTCGAGGGCATGTTTCGCGATTTGTCGGCATCTGAGGATCTTACGTCGGGCTATCGCCATT
ACATGAGCAAGCTGGGAGACTCGCCGAGTATCGAGCTCAATGTCAATGTCTTGACGACCAACTACTGGCCACACG
AAATCATGGGGCGTCAAGCATCAATTGGGGAAGGGTCTAGGATCTCGTGCACATACCCGCGCCAAATCAAGACGC
TTCAAGCAAGCTTTGGACAGTATTACCTCACGGACCGTAGCGGGCGAAAGCTGACGTGGGTTGGGACAATGGGCA
GTGCCGACATCAAGTGCACCTTTCCGGCCATTGCAGGCAAGTCGGGGGCTCTCGGTCGCGAACGACGCTATGATA
TAATTGTGCCAACATTTGCCATGGTGGTGATGCTGCTCTTTAACGATTTGGATGTGGACCAGGGCCTGTCATTTG
ACGAGATCCAGGCCCGCACAGGCATTACACCCCAGGATCTTATGAGGACCCTGACTGCCATTGCAGTTGCGCCCA
AGTCGCGCGTTCTTTTGAAGGAGCCGGCGTCCAAGATGGTCAAGACGAGCGACAAATTTTACTTCAACGCCTCTT
TCCAGAGCAAGACTGTACGCATCAAGGCACCCGTCATCAACGCCGTGTCCAAAGTGGAGGACAAGGAAGACAGAC
AGGCTACTGAAGACAAGAACCTCCAGACCAGGTCGCATATTATCGACGCGGCCGTTGTGAGAATCATGAAGTGAG
TTTTGCTCTCTCACGTTGTGACGAGAGCTAGGACTAACGGAAATGGCAACGCAGGTCACGTAAAGAGTTGGGGCA
TACGCAACTTGTCAGCGAAGTTATGGGGCAGCTGTCATCGCGCTTCAAACCTGAGCCGTGGCTCATTAAGAAACG
CATCGAAGACCTGATTGTACGCGAGTATCTGGAGCGGCCAGACGAAGAAGGGGCGCCGTCAATGTACCGCTACGT
GGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail