Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|76
Gene name
LocationContig_100:10813..11870
Strand-
Gene length (bp)1057
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00900 Ribosomal_S4e Ribosomal family S4e 3.1E-35 95 169
PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus 3.9E-24 212 256
PF08071 RS4NT RS4NT (NUC023) domain 3.8E-18 3 39
PF01479 S4 S4 domain 1.7E-06 42 90
PF00467 KOW KOW motif 1.5E-05 178 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59950|RS4_YARLI 40S ribosomal protein S4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS4 PE=2 SV=1 1 256 3.0E-148
sp|P0CX36|RS4B_YEAST 40S ribosomal protein S4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4B PE=1 SV=1 1 256 9.0E-148
sp|P0CX35|RS4A_YEAST 40S ribosomal protein S4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4A PE=1 SV=1 1 256 9.0E-148
sp|P87158|RS4A_SCHPO 40S ribosomal protein S4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps401 PE=2 SV=2 1 257 2.0E-144
sp|Q9USW5|RS4B_SCHPO 40S ribosomal protein S4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps402 PE=1 SV=1 1 257 6.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59950|RS4_YARLI 40S ribosomal protein S4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS4 PE=2 SV=1 1 256 3.0E-148
sp|P0CX36|RS4B_YEAST 40S ribosomal protein S4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4B PE=1 SV=1 1 256 9.0E-148
sp|P0CX35|RS4A_YEAST 40S ribosomal protein S4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4A PE=1 SV=1 1 256 9.0E-148
sp|P87158|RS4A_SCHPO 40S ribosomal protein S4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps401 PE=2 SV=2 1 257 2.0E-144
sp|Q9USW5|RS4B_SCHPO 40S ribosomal protein S4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps402 PE=1 SV=1 1 257 6.0E-144
sp|Q9P4W9|RS4C_SCHPO 40S ribosomal protein S4-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps403 PE=1 SV=1 1 257 1.0E-143
sp|P47961|RS4_CRIGR 40S ribosomal protein S4 OS=Cricetulus griseus GN=RPS4 PE=2 SV=2 1 260 2.0E-143
sp|P79103|RS4_BOVIN 40S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=2 SV=3 1 260 1.0E-142
sp|P62703|RS4X_RAT 40S ribosomal protein S4, X isoform OS=Rattus norvegicus GN=Rps4x PE=2 SV=2 1 260 1.0E-142
sp|P62702|RS4X_MOUSE 40S ribosomal protein S4, X isoform OS=Mus musculus GN=Rps4x PE=1 SV=2 1 260 1.0E-142
sp|P62704|RS4X_MESAU 40S ribosomal protein S4, X isoform OS=Mesocricetus auratus GN=RPS4X PE=2 SV=2 1 260 1.0E-142
sp|Q76MY1|RS4X_MACFU 40S ribosomal protein S4, X isoform OS=Macaca fuscata fuscata GN=RPS4X PE=2 SV=3 1 260 1.0E-142
sp|P62701|RS4X_HUMAN 40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2 1 260 1.0E-142
sp|P62705|RS4X_FELCA 40S ribosomal protein S4, X isoform OS=Felis catus GN=RPS4X PE=2 SV=2 1 260 1.0E-142
sp|Q76N24|RS4X_CHLAE 40S ribosomal protein S4, X isoform OS=Chlorocebus aethiops GN=RPS4X PE=2 SV=3 1 260 1.0E-142
sp|P47836|RS4_CHICK 40S ribosomal protein S4 OS=Gallus gallus GN=RPS4 PE=2 SV=2 1 260 2.0E-142
sp|Q642H9|RS4X_DANRE 40S ribosomal protein S4, X isoform OS=Danio rerio GN=rps4x PE=2 SV=3 1 260 2.0E-142
sp|Q6PBC4|RS4_XENTR 40S ribosomal protein S4 OS=Xenopus tropicalis GN=rps4 PE=2 SV=3 1 260 2.0E-142
sp|P49401|RS4_XENLA 40S ribosomal protein S4 OS=Xenopus laevis GN=rps4 PE=2 SV=4 1 260 3.0E-142
sp|Q90YS0|RS4_ICTPU 40S ribosomal protein S4 OS=Ictalurus punctatus GN=rps4 PE=2 SV=3 1 260 9.0E-142
sp|O62739|RS4Y1_MONDO 40S ribosomal protein S4, Y isoform 1 OS=Monodelphis domestica GN=RPS4Y1 PE=2 SV=3 1 260 5.0E-141
sp|P79183|RS4Y1_MACFU 40S ribosomal protein S4, Y isoform 1 OS=Macaca fuscata fuscata GN=RPS4Y1 PE=2 SV=3 1 260 7.0E-140
sp|Q6GVM7|RS4Y2_PANTR 40S ribosomal protein S4, Y isoform 2 OS=Pan troglodytes GN=RPS4Y2 PE=2 SV=3 1 260 2.0E-139
sp|P22090|RS4Y1_HUMAN 40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens GN=RPS4Y1 PE=1 SV=2 1 260 5.0E-139
sp|O62738|RS4X_MONDO 40S ribosomal protein S4, X isoform OS=Monodelphis domestica GN=RPS4X PE=2 SV=3 1 261 6.0E-139
sp|Q861U8|RS4Y1_GORGO 40S ribosomal protein S4, Y isoform 1 OS=Gorilla gorilla gorilla GN=RPS4Y1 PE=3 SV=2 1 260 6.0E-139
sp|Q861U7|RS4Y1_PONPY 40S ribosomal protein S4, Y isoform 1 OS=Pongo pygmaeus GN=RPS4Y1 PE=3 SV=2 1 260 3.0E-138
sp|Q861U9|RS4Y1_PANTR 40S ribosomal protein S4, Y isoform 1 OS=Pan troglodytes GN=RPS4Y1 PE=2 SV=2 1 260 4.0E-138
sp|Q861V0|RS4Y1_PANPA 40S ribosomal protein S4, Y isoform 1 OS=Pan paniscus GN=RPS4Y1 PE=3 SV=2 1 260 4.0E-138
sp|P47837|RS4_CANAX 40S ribosomal protein S4 OS=Candida albicans GN=RPS4 PE=3 SV=1 1 256 6.0E-137
sp|Q8TD47|RS4Y2_HUMAN 40S ribosomal protein S4, Y isoform 2 OS=Homo sapiens GN=RPS4Y2 PE=2 SV=3 1 260 3.0E-135
sp|Q4PMB3|RS4_IXOSC 40S ribosomal protein S4 OS=Ixodes scapularis GN=RpS4 PE=2 SV=1 1 261 2.0E-133
sp|P41042|RS4_DROME 40S ribosomal protein S4 OS=Drosophila melanogaster GN=RpS4 PE=1 SV=2 1 261 3.0E-133
sp|Q95V34|RS4_SPOFR 40S ribosomal protein S4 OS=Spodoptera frugiperda GN=RpS4 PE=2 SV=1 1 256 1.0E-131
sp|Q4GXU6|RS4_CARGR 40S ribosomal protein S4 OS=Carabus granulatus GN=RpS4 PE=2 SV=1 1 261 1.0E-130
sp|Q5UAP0|RS4_BOMMO 40S ribosomal protein S4 OS=Bombyx mori GN=RpS4 PE=2 SV=1 1 256 4.0E-130
sp|Q56FH2|RS4_LYSTE 40S ribosomal protein S4 OS=Lysiphlebus testaceipes GN=RpS4 PE=2 SV=1 1 256 8.0E-129
sp|P49398|RS4_ORYSJ 40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3 1 254 1.0E-127
sp|O22424|RS4_MAIZE 40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1 1 254 2.0E-127
sp|P49204|RS42_ARATH 40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4 1 260 5.0E-127
sp|Q8VYK6|RS43_ARATH 40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2 1 260 5.0E-127
sp|P46300|RS4_SOLTU 40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1 1 260 1.0E-126
sp|Q93VH9|RS41_ARATH 40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1 1 260 1.0E-126
sp|P46299|RS4_GOSHI 40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1 1 260 1.0E-124
sp|O81363|RS4_PRUAR 40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1 1 254 4.0E-116
sp|P51405|RS4_DICDI 40S ribosomal protein S4 OS=Dictyostelium discoideum GN=rps4 PE=1 SV=3 1 252 8.0E-116
sp|Q9N3X2|RS4_CAEEL 40S ribosomal protein S4 OS=Caenorhabditis elegans GN=rps-4 PE=1 SV=1 3 261 2.0E-112
sp|P55832|RS4_HORSE 40S ribosomal protein S4 (Fragment) OS=Equus caballus GN=RPS4 PE=2 SV=1 20 213 5.0E-107
sp|P0C233|RS4_TETTH 40S ribosomal protein S4 OS=Tetrahymena thermophila PE=1 SV=1 2 254 1.0E-89
sp|Q8SRB9|RS4_ENCCU 40S ribosomal protein S4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS4 PE=1 SV=1 1 250 6.0E-57
sp|A2BMD1|RS4E_HYPBU 30S ribosomal protein S4e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4e PE=3 SV=1 1 240 5.0E-46
sp|A3DNB9|RS4E_STAMF 30S ribosomal protein S4e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4e PE=3 SV=1 1 240 5.0E-44
sp|Q9YF85|RS4E_AERPE 30S ribosomal protein S4e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4e PE=3 SV=2 1 240 1.0E-43
sp|O26123|RS4E_METTH 30S ribosomal protein S4e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps4e PE=3 SV=1 6 241 2.0E-43
sp|Q2NFW9|RS4E_METST 30S ribosomal protein S4e OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps4e PE=3 SV=1 4 237 3.0E-42
sp|Q5JJG0|RS4E_THEKO 30S ribosomal protein S4e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4e PE=3 SV=1 1 238 6.0E-42
sp|O59430|RS4E_PYRHO 30S ribosomal protein S4e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps4e PE=3 SV=1 1 238 8.0E-42
sp|A8ACD4|RS4E_IGNH4 30S ribosomal protein S4e OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4e PE=3 SV=1 1 240 5.0E-41
sp|Q9V1U8|RS4E_PYRAB 30S ribosomal protein S4e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps4e PE=3 SV=1 1 238 1.0E-40
sp|Q8U011|RS4E_PYRFU 30S ribosomal protein S4e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps4e PE=1 SV=1 1 238 2.0E-39
sp|A4FWA9|RS4E_METM5 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps4e PE=3 SV=1 3 237 3.0E-39
sp|P54039|RS4E_METJA 30S ribosomal protein S4e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps4e PE=3 SV=1 3 237 4.0E-39
sp|A6UQ56|RS4E_METVS 30S ribosomal protein S4e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps4e PE=3 SV=1 3 237 9.0E-39
sp|P14023|RS4E_METVA 30S ribosomal protein S4e OS=Methanococcus vannielii GN=rps4e PE=3 SV=1 3 237 9.0E-39
sp|A6VGZ7|RS4E_METM7 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps4e PE=3 SV=1 3 237 2.0E-38
sp|A9A9Q2|RS4E_METM6 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps4e PE=3 SV=1 3 237 3.0E-38
sp|P62428|RS4E_METMP 30S ribosomal protein S4e OS=Methanococcus maripaludis (strain S2 / LL) GN=rps4e PE=3 SV=1 3 237 8.0E-38
sp|A5UL76|RS4E_METS3 30S ribosomal protein S4e OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps4e PE=3 SV=1 1 237 5.0E-37
sp|B1L778|RS4E_KORCO 30S ribosomal protein S4e OS=Korarchaeum cryptofilum (strain OPF8) GN=rps4e PE=3 SV=1 4 237 3.0E-36
sp|B8D5V8|RS4E_DESK1 30S ribosomal protein S4e OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps4e PE=3 SV=1 2 240 1.0E-35
sp|Q8TW18|RS4E_METKA 30S ribosomal protein S4e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps4e PE=3 SV=1 4 239 1.0E-33
sp|O28366|RS4E_ARCFU 30S ribosomal protein S4e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4e PE=3 SV=1 5 237 3.0E-33
sp|Q8TRT5|RS4E_METAC 30S ribosomal protein S4e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps4e PE=3 SV=1 8 237 1.0E-31
sp|A6UWV0|RS4E_META3 30S ribosomal protein S4e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps4e PE=3 SV=1 3 237 2.0E-31
sp|Q46GA7|RS4E_METBF 30S ribosomal protein S4e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps4e PE=3 SV=1 8 237 5.0E-31
sp|A1RS06|RS4E_PYRIL 30S ribosomal protein S4e OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps4e PE=3 SV=1 8 193 1.0E-30
sp|B1Y9S4|RS4E_PYRNV 30S ribosomal protein S4e OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps4e PE=3 SV=1 8 190 2.0E-29
sp|Q8PV38|RS4E_METMA 30S ribosomal protein S4e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps4e PE=3 SV=1 8 237 2.0E-29
sp|Q97BW4|RS4E_THEVO 30S ribosomal protein S4e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps4e PE=3 SV=1 10 241 3.0E-29
sp|Q8ZTD3|RS4E_PYRAE 30S ribosomal protein S4e OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps4e PE=3 SV=1 8 237 1.0E-28
sp|Q0W1X6|RS4E_METAR 30S ribosomal protein S4e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4e PE=3 SV=1 8 235 2.0E-28
sp|A4WLL4|RS4E_PYRAR 30S ribosomal protein S4e OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps4e PE=3 SV=1 8 193 2.0E-28
sp|A3MWZ7|RS4E_PYRCJ 30S ribosomal protein S4e OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps4e PE=3 SV=1 8 193 2.0E-28
sp|A8MB20|RS4E_CALMQ 30S ribosomal protein S4e OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4e PE=3 SV=1 8 233 4.0E-28
sp|C3NEF5|RS4E_SULIY 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps4e PE=3 SV=1 8 232 1.0E-27
sp|C3NH97|RS4E_SULIN 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps4e PE=3 SV=1 8 232 1.0E-27
sp|C3MVJ0|RS4E_SULIM 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps4e PE=3 SV=1 8 232 1.0E-27
sp|C3MQ71|RS4E_SULIL 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps4e PE=3 SV=1 8 232 1.0E-27
sp|C4KHG8|RS4E_SULIK 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps4e PE=3 SV=1 8 232 1.0E-27
sp|C3N5T9|RS4E_SULIA 30S ribosomal protein S4e OS=Sulfolobus islandicus (strain M.16.27) GN=rps4e PE=3 SV=1 8 232 1.0E-27
sp|Q56230|RS4E_THEAC 30S ribosomal protein S4e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps4e PE=1 SV=2 10 232 4.0E-27
sp|Q40941|RS4_BIGNA 40S ribosomal protein S4 OS=Bigelowiella natans GN=RPS4 PE=3 SV=1 1 235 1.0E-26
sp|P62429|RS4E_NANEQ 30S ribosomal protein S4e OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps4e PE=3 SV=1 1 223 9.0E-26
sp|Q9UX94|RS4E_SULSO 30S ribosomal protein S4e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps4e PE=3 SV=1 8 232 3.0E-25
sp|B9LSR5|RS4E_HALLT 30S ribosomal protein S4e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps4e PE=3 SV=1 5 231 2.0E-24
sp|Q975J2|RS4E_SULTO 30S ribosomal protein S4e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4e PE=3 SV=2 8 232 3.0E-24
sp|O05634|RS4E_SULAC 30S ribosomal protein S4e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4e PE=3 SV=1 8 245 1.0E-23
sp|Q3IMX6|RS4E_NATPD 30S ribosomal protein S4e OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps4e PE=3 SV=1 5 231 2.0E-23
sp|Q2FT37|RS4E_METHJ 30S ribosomal protein S4e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps4e PE=3 SV=1 8 235 2.0E-23
sp|P22510|RS4E_HALMA 30S ribosomal protein S4E OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps4e PE=1 SV=3 5 231 8.0E-23
sp|Q6L1B5|RS4E_PICTO 30S ribosomal protein S4e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps4e PE=3 SV=1 10 240 2.0E-22
sp|Q9HPC2|RS4E_HALSA 30S ribosomal protein S4e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps4e PE=3 SV=1 5 231 2.0E-21
sp|B0R668|RS4E_HALS3 30S ribosomal protein S4e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps4e PE=3 SV=1 5 231 2.0E-21
sp|A4YCX8|RS4E_METS5 30S ribosomal protein S4e OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps4e PE=3 SV=1 8 233 4.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1467
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|76 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5747
Ophiocordyceps camponoti-floridani Ophcf2|06442
Ophiocordyceps camponoti-rufipedis Ophun1|6093
Ophiocordyceps kimflemingae Ophio5|5984
Ophiocordyceps subramaniannii Hirsu2|11051

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|76
MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRECKAILMQRLVKVDGK
VRTDMTYPAGFMDVISIEKTGENFRLIYDTKGRFTVHRIQTEEAEYKLGKVKRVQLGRGGIPFLVTHDARTIRYP
DPLIKVNDTVKIDLKTGKVTDFIKFDTGAIAMVTGGRNMGRVGVITHRERHDGGFNIVHIKDAIDNTFATRENNV
FVIGQDKPWISLPKGKGVKLTIAEERDRRRAIAQSH*
Coding >OphauG2|76
ATGGCTCGAGGAATTAAAAAGCATCAGAAGCGCCTCAGCGCGCCTTCGCACTGGTTGCTCGACAAGCTATCTGGT
GTTTATGCACCAAAGCCGTCGGCCGGTCCTCACAAGCTCCGCGACTGCATGCCTCTTATTGTCTTCATCCGCAAT
CGCCTCAAGTATGCACTCAACTATCGCGAGTGCAAGGCCATCCTCATGCAGCGCCTTGTCAAGGTCGACGGCAAG
GTCCGCACCGATATGACTTATCCTGCTGGCTTTATGGATGTCATTAGCATTGAAAAGACGGGCGAAAATTTTCGG
CTCATCTACGACACCAAGGGCCGATTTACTGTGCACCGAATTCAGACCGAGGAGGCTGAATACAAGTTGGGCAAG
GTCAAGCGTGTTCAGCTTGGCCGTGGTGGAATCCCATTCTTGGTGACGCACGATGCGAGAACCATTCGCTACCCC
GACCCGCTCATCAAGGTCAATGACACTGTCAAGATTGACCTCAAGACGGGCAAAGTGACCGACTTTATCAAATTC
GACACGGGCGCCATAGCCATGGTGACTGGTGGTCGCAACATGGGTCGTGTTGGTGTCATTACGCATCGTGAGCGC
CACGACGGGGGCTTCAACATTGTTCACATCAAGGACGCTATAGACAACACTTTTGCTACTCGTGAGAACAACGTT
TTTGTCATTGGGCAGGATAAGCCTTGGATCTCTCTGCCAAAGGGCAAGGGTGTCAAGCTCACGATTGCCGAGGAA
CGTGATCGTCGGCGGGCTATTGCTCAGTCTCACTAG
Transcript >OphauG2|76
ATGGCTCGAGGAATTAAAAAGCATCAGAAGCGCCTCAGCGCGCCTTCGCACTGGTTGCTCGACAAGCTATCTGGT
GTTTATGCACCAAAGCCGTCGGCCGGTCCTCACAAGCTCCGCGACTGCATGCCTCTTATTGTCTTCATCCGCAAT
CGCCTCAAGTATGCACTCAACTATCGCGAGTGCAAGGCCATCCTCATGCAGCGCCTTGTCAAGGTCGACGGCAAG
GTCCGCACCGATATGACTTATCCTGCTGGCTTTATGGATGTCATTAGCATTGAAAAGACGGGCGAAAATTTTCGG
CTCATCTACGACACCAAGGGCCGATTTACTGTGCACCGAATTCAGACCGAGGAGGCTGAATACAAGTTGGGCAAG
GTCAAGCGTGTTCAGCTTGGCCGTGGTGGAATCCCATTCTTGGTGACGCACGATGCGAGAACCATTCGCTACCCC
GACCCGCTCATCAAGGTCAATGACACTGTCAAGATTGACCTCAAGACGGGCAAAGTGACCGACTTTATCAAATTC
GACACGGGCGCCATAGCCATGGTGACTGGTGGTCGCAACATGGGTCGTGTTGGTGTCATTACGCATCGTGAGCGC
CACGACGGGGGCTTCAACATTGTTCACATCAAGGACGCTATAGACAACACTTTTGCTACTCGTGAGAACAACGTT
TTTGTCATTGGGCAGGATAAGCCTTGGATCTCTCTGCCAAAGGGCAAGGGTGTCAAGCTCACGATTGCCGAGGAA
CGTGATCGTCGGCGGGCTATTGCTCAGTCTCACTAG
Gene >OphauG2|76
ATGGCTCGAGGAATGTAAGTACAAGTCAAAGTCTAGAATCAAATCGCTCATCATACCGTGCAGCAGGAATTGAGC
TGCTGCTGGATTACTGCTGTCGTGGACAGTCATTATACAAGAGCATGGACGCTGATTGCACTGCAGTAAAAAGCA
TCAGAAGCGCCTCAGCGCGCCTTCGCACTGGTTGCTCGACAAGCTATCTGGTGTTTATGCACCAAAGCCGTCGGC
CGGTCCTCACAAGCTCCGCGACTGCATGCCTCTTATTGTCTTCATCCGCAATCGCCTCAAGTATGCACTCAACTA
TCGCGAGTGCAAGGCCATCCTCATGCAGCGCCTTGTCAAGGTCGACGGCAAGGTCCGCACCGATATGACTTATCC
TGCTGGCTTTATGGATGTCATTAGCATTGAAAAGACGGGCGAAAATTTTCGGCTCATCTACGACACCAAGGGCCG
ATTTACTGTGCACCGAATTCAGACCGAGGAGGCTGAATACAAGTTGGGCAAGGTCAAGCGTGTTCAGCTTGGCCG
TGGTGGAATCCCATTCTTGGTGACGCACGATGCGAGAACGTGAGTTCTGTCAGACATCATTCAGCCGTTGAATCA
AGCTTTGGTAGATTCGGAGTCACCAGACGACGCGTCGATGGAGCTGGATTTGACGGTTGTGAGTCGTCTCTTTTG
CCGTCTGGAATGCTAATGCCTTGTTGCCTCCAGCATTCGCTACCCCGACCCGCTCATCAAGGTCAATGACACTGT
CAAGATTGACCTCAAGACGGGCAAAGTGACCGACTTTATCAAATTCGACACGGGCGCCATAGCCATGGTGACTGG
TGGTCGCAACATGGGTCGTGTTGGTGTCATTACGCATCGTGAGCGCCACGACGGGGGCTTCAACATTGTTCACAT
CAAGGACGCTATAGACAACACTTTTGCTACTCGTGAGAACAACGTTTTTGTCATTGGGCAGGATAAGCCTTGGAT
CTCTCTGCCAAAGGGCAAGGGTGTCAAGCTCACGATTGCCGAGGAACGTGATCGTCGGCGGGCTATTGCTCAGTC
TCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail