© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|7587 |
| Gene name | |
| Location | Contig_9:66682..67422 |
| Strand | - |
| Gene length (bp) | 740 |
| Transcript length (bp) | 561 |
| Coding sequence length (bp) | 561 |
| Protein length (aa) | 187 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00071 | Ras | Ras family | 4.6E-44 | 8 | 169 |
| PF08477 | Roc | Ras of Complex, Roc, domain of DAPkinase | 1.8E-15 | 8 | 122 |
| PF00025 | Arf | ADP-ribosylation factor family | 3.2E-07 | 4 | 162 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94363|RHB1_SCHPO | GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 | 1 | 185 | 4.0E-89 |
| sp|Q550Q4|RHEB_DICDI | GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 | 1 | 186 | 2.0E-61 |
| sp|Q9VND8|RHEB_DROME | GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 | 1 | 183 | 3.0E-58 |
| sp|Q921J2|RHEB_MOUSE | GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 | 1 | 186 | 1.0E-57 |
| sp|Q15382|RHEB_HUMAN | GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 | 1 | 186 | 2.0E-57 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94363|RHB1_SCHPO | GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 | 1 | 185 | 4.0E-89 |
| sp|Q550Q4|RHEB_DICDI | GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 | 1 | 186 | 2.0E-61 |
| sp|Q9VND8|RHEB_DROME | GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 | 1 | 183 | 3.0E-58 |
| sp|Q921J2|RHEB_MOUSE | GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 | 1 | 186 | 1.0E-57 |
| sp|Q15382|RHEB_HUMAN | GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 | 1 | 186 | 2.0E-57 |
| sp|Q62639|RHEB_RAT | GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 | 1 | 186 | 2.0E-57 |
| sp|Q56JV3|RHEB_BOVIN | GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 | 1 | 186 | 1.0E-56 |
| sp|Q8TAI7|REBL1_HUMAN | GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1 | 1 | 186 | 1.0E-48 |
| sp|Q9D8T3|REBL1_MOUSE | GTPase RhebL1 OS=Mus musculus GN=Rhebl1 PE=2 SV=1 | 1 | 186 | 2.0E-48 |
| sp|Q7TNZ5|REBL1_RAT | GTPase RhebL1 OS=Rattus norvegicus GN=Rhebl1 PE=2 SV=1 | 1 | 173 | 4.0E-47 |
| sp|P25378|RHEB_YEAST | Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 | 6 | 186 | 6.0E-47 |
| sp|Q7YS69|REBL1_BOVIN | GTPase RhebL1 OS=Bos taurus GN=RHEBL1 PE=2 SV=1 | 18 | 186 | 2.0E-40 |
| sp|P32253|RASC_DICDI | Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 | 4 | 186 | 6.0E-39 |
| sp|Q9YH37|RAP1B_CYPCA | Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 | 5 | 186 | 5.0E-36 |
| sp|Q94694|RAP1_PHYPO | Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 | 1 | 186 | 7.0E-36 |
| sp|A6NIZ1|RP1BL_HUMAN | Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 | 5 | 186 | 1.0E-35 |
| sp|Q640R7|RAP1B_XENTR | Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 | 5 | 186 | 2.0E-35 |
| sp|Q7ZXH7|RAP1B_XENLA | Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 | 5 | 186 | 2.0E-35 |
| sp|Q62636|RAP1B_RAT | Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 | 5 | 186 | 6.0E-35 |
| sp|Q5RDM6|RAP1B_PONAB | Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 | 5 | 186 | 6.0E-35 |
| sp|A5A6J7|RAP1B_PANTR | Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 | 5 | 186 | 6.0E-35 |
| sp|Q99JI6|RAP1B_MOUSE | Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 | 5 | 186 | 6.0E-35 |
| sp|Q4R9D4|RAP1B_MACFA | Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 | 5 | 186 | 6.0E-35 |
| sp|P61224|RAP1B_HUMAN | Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 | 5 | 186 | 6.0E-35 |
| sp|Q5ZHX1|RAP1B_CHICK | Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 | 5 | 186 | 6.0E-35 |
| sp|P61223|RAP1B_BOVIN | Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 | 5 | 186 | 6.0E-35 |
| sp|Q55CB7|RASY_DICDI | Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 | 8 | 181 | 1.0E-34 |
| sp|Q55CC0|RASW_DICDI | Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 | 9 | 174 | 1.0E-33 |
| sp|P08645|RAS3_DROME | Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 | 5 | 168 | 1.0E-33 |
| sp|Q6TEN1|RAP1B_DANRE | Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 | 5 | 186 | 2.0E-33 |
| sp|P22279|RAS2_MUCCL | Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 | 5 | 171 | 2.0E-33 |
| sp|Q55CA9|RASZ_DICDI | Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 | 8 | 172 | 2.0E-33 |
| sp|P18613|RAPA_DICDI | Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 | 1 | 181 | 3.0E-33 |
| sp|P34443|RHEB1_CAEEL | GTP-binding protein Rheb homolog 1 OS=Caenorhabditis elegans GN=rheb-1 PE=3 SV=1 | 6 | 179 | 8.0E-33 |
| sp|P03967|RASD_DICDI | Ras-like protein rasD OS=Dictyostelium discoideum GN=rasD PE=2 SV=2 | 8 | 180 | 1.0E-32 |
| sp|A8XAD0|RHEB1_CAEBR | GTP-binding protein Rheb homolog 1 OS=Caenorhabditis briggsae GN=rheb-1 PE=3 SV=1 | 7 | 180 | 8.0E-32 |
| sp|Q18246|RAP1_CAEEL | Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 | 5 | 170 | 1.0E-31 |
| sp|P62836|RAP1A_RAT | Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 | 5 | 170 | 1.0E-31 |
| sp|P62835|RAP1A_MOUSE | Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 | 5 | 170 | 1.0E-31 |
| sp|P62834|RAP1A_HUMAN | Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 | 5 | 170 | 1.0E-31 |
| sp|P62833|RAP1A_BOVIN | Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 | 5 | 170 | 1.0E-31 |
| sp|P32254|RASS_DICDI | Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 | 8 | 172 | 2.0E-31 |
| sp|P22123|RAPA_DIPOM | Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 | 5 | 170 | 3.0E-31 |
| sp|P34726|RAS2_PHYPO | Ras-like protein 2 OS=Physarum polycephalum GN=RAS-2 PE=2 SV=1 | 8 | 170 | 3.0E-31 |
| sp|P34729|RAS1_PHYPO | Ras-like protein 1 OS=Physarum polycephalum GN=RAS1 PE=2 SV=1 | 8 | 170 | 3.0E-31 |
| sp|P23175|RASH_MSVNS | GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 | 8 | 182 | 4.0E-31 |
| sp|Q55CB8|RASX_DICDI | Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 | 8 | 170 | 4.0E-31 |
| sp|P15064|RASG_DICDI | Ras-like protein rasG OS=Dictyostelium discoideum GN=rasG PE=1 SV=1 | 8 | 180 | 7.0E-31 |
| sp|P11233|RALA_HUMAN | Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 | 8 | 168 | 1.0E-30 |
| sp|P63320|RALA_SAGOE | Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 | 8 | 168 | 4.0E-30 |
| sp|P63322|RALA_RAT | Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 | 8 | 168 | 4.0E-30 |
| sp|P63321|RALA_MOUSE | Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 | 8 | 168 | 4.0E-30 |
| sp|Q01387|RAS2_NEUCR | Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 | 8 | 177 | 4.0E-30 |
| sp|P01113|RASH_MSVMO | GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 | 8 | 182 | 6.0E-30 |
| sp|P01115|RASH_MSVHA | Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 | 8 | 186 | 6.0E-30 |
| sp|Q86L51|RAPB_DICDI | Ras-related protein rapB OS=Dictyostelium discoideum GN=rapB PE=3 SV=1 | 9 | 186 | 7.0E-30 |
| sp|C4YKT4|RAS1_CANAW | Ras-like protein 1 OS=Candida albicans (strain WO-1) GN=RAS1 PE=3 SV=1 | 19 | 170 | 7.0E-30 |
| sp|P0CY32|RAS1_CANAX | Ras-like protein 1 OS=Candida albicans GN=RAS1 PE=3 SV=1 | 19 | 170 | 7.0E-30 |
| sp|P22126|RAS1_NEUCR | Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 | 4 | 170 | 7.0E-30 |
| sp|Q55CB9|RASV_DICDI | Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 | 8 | 172 | 9.0E-30 |
| sp|P22280|RAS3_MUCCL | Ras-like protein 3 OS=Mucor circinelloides f. lusitanicus GN=RAS3 PE=2 SV=1 | 19 | 182 | 1.0E-29 |
| sp|P08647|RAS_SCHPO | Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 | 1 | 170 | 2.0E-29 |
| sp|Q59XU5|RAS1_CANAL | Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=1 | 19 | 170 | 2.0E-29 |
| sp|P87018|RAS_BOTFU | Ras-like protein OS=Botryotinia fuckeliana GN=ras1 PE=3 SV=1 | 19 | 170 | 3.0E-29 |
| sp|Q55CB0|RASU_DICDI | Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 | 8 | 161 | 3.0E-29 |
| sp|P01114|RASH_RRASV | Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 | 8 | 182 | 4.0E-29 |
| sp|Q12526|RAS_EMENI | Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rasA PE=2 SV=2 | 19 | 182 | 4.0E-29 |
| sp|P32252|RASB_DICDI | Ras-like protein rasB OS=Dictyostelium discoideum GN=rasB PE=1 SV=1 | 1 | 175 | 6.0E-29 |
| sp|P28775|RAS_LENED | Ras-like protein OS=Lentinula edodes PE=3 SV=1 | 19 | 170 | 7.0E-29 |
| sp|Q05058|RASL_COPCI | 24 kDa Ras-like protein OS=Coprinopsis cinerea GN=CC-RAS PE=3 SV=1 | 19 | 170 | 9.0E-29 |
| sp|A8NU18|RASL_COPC7 | 24 kDa Ras-like protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC-RAS PE=3 SV=3 | 19 | 170 | 9.0E-29 |
| sp|P01117|RASK_MSVKI | GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 | 8 | 170 | 1.0E-28 |
| sp|P22278|RAS1_MUCCL | Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 | 5 | 170 | 1.0E-28 |
| sp|P0CQ42|RAS_CRYNJ | Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAS1 PE=2 SV=1 | 19 | 179 | 2.0E-28 |
| sp|P0CQ43|RAS_CRYNB | Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAS1 PE=3 SV=1 | 19 | 179 | 2.0E-28 |
| sp|Q5R988|RAP2A_PONAB | Ras-related protein Rap-2a OS=Pongo abelii GN=RAP2A PE=2 SV=2 | 19 | 185 | 2.0E-28 |
| sp|Q80ZJ1|RAP2A_MOUSE | Ras-related protein Rap-2a OS=Mus musculus GN=Rap2a PE=1 SV=2 | 19 | 185 | 2.0E-28 |
| sp|P48555|RALA_DROME | Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 | 8 | 182 | 3.0E-28 |
| sp|O42785|RASL_COLTR | Ras-like protein OS=Colletotrichum trifolii GN=RAS PE=2 SV=1 | 19 | 170 | 4.0E-28 |
| sp|O93856|RAS_LACBI | Ras-like protein OS=Laccaria bicolor PE=2 SV=1 | 19 | 182 | 5.0E-28 |
| sp|Q5R4B8|RALB_PONAB | Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 | 8 | 168 | 7.0E-28 |
| sp|P11234|RALB_HUMAN | Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 | 8 | 168 | 7.0E-28 |
| sp|Q4R379|RALB_MACFA | Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 | 8 | 168 | 8.0E-28 |
| sp|P36860|RALB_RAT | Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 | 8 | 182 | 1.0E-27 |
| sp|P62071|RRAS2_MOUSE | Ras-related protein R-Ras2 OS=Mus musculus GN=Rras2 PE=1 SV=1 | 19 | 183 | 1.0E-27 |
| sp|P62070|RRAS2_HUMAN | Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1 | 19 | 183 | 1.0E-27 |
| sp|B4PUP5|RAS1_DROYA | Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 | 19 | 173 | 2.0E-27 |
| sp|P83831|RAS1_DROSI | Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 | 19 | 173 | 2.0E-27 |
| sp|B4HKC7|RAS1_DROSE | Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 | 19 | 173 | 2.0E-27 |
| sp|P08646|RAS1_DROME | Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 | 19 | 173 | 2.0E-27 |
| sp|P83832|RAS1_DROMA | Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 | 19 | 173 | 2.0E-27 |
| sp|B3NZR4|RAS1_DROER | Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 | 19 | 173 | 2.0E-27 |
| sp|B3M185|RAS1_DROAN | Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 | 19 | 173 | 2.0E-27 |
| sp|P18262|RAS_ARTSA | Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 | 17 | 172 | 2.0E-27 |
| sp|B4LY29|RAS1_DROVI | Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 | 19 | 182 | 2.0E-27 |
| sp|B4JFU8|RAS1_DROGR | Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 | 19 | 182 | 2.0E-27 |
| sp|Q295X7|RAS1_DROPS | Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 | 19 | 173 | 3.0E-27 |
| sp|B4GFJ8|RAS1_DROPE | Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 | 19 | 173 | 3.0E-27 |
| sp|B4NJ72|RAS1_DROWI | Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 | 19 | 173 | 3.0E-27 |
| sp|P70426|RIT1_MOUSE | GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 | 4 | 173 | 4.0E-27 |
| sp|Q9JIW9|RALB_MOUSE | Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 | 8 | 182 | 4.0E-27 |
| sp|P61227|RAP2B_RAT | Ras-related protein Rap-2b OS=Rattus norvegicus GN=Rap2b PE=2 SV=1 | 19 | 186 | 4.0E-27 |
| sp|P61226|RAP2B_MOUSE | Ras-related protein Rap-2b OS=Mus musculus GN=Rap2b PE=1 SV=1 | 19 | 186 | 4.0E-27 |
| sp|P61225|RAP2B_HUMAN | Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1 | 19 | 186 | 4.0E-27 |
| sp|Q06AU2|RAP2A_PIG | Ras-related protein Rap-2a OS=Sus scrofa GN=RAP2A PE=2 SV=1 | 19 | 186 | 4.0E-27 |
| sp|Q5R6S2|DIRA2_PONAB | GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 | 8 | 165 | 5.0E-27 |
| sp|P22124|RAL_DIPOM | Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 | 8 | 182 | 5.0E-27 |
| sp|P13856|RSR1_YEAST | Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 | 8 | 168 | 5.0E-27 |
| sp|Q9YH09|RALBA_XENLA | Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 | 8 | 168 | 5.0E-27 |
| sp|Q99578|RIT2_HUMAN | GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 | 4 | 173 | 6.0E-27 |
| sp|Q5PR73|DIRA2_MOUSE | GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 | 8 | 165 | 8.0E-27 |
| sp|Q96HU8|DIRA2_HUMAN | GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 | 8 | 165 | 8.0E-27 |
| sp|Q95KD9|DIRA2_MACFA | GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 | 8 | 165 | 1.0E-26 |
| sp|P10301|RRAS_HUMAN | Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1 | 19 | 182 | 1.0E-26 |
| sp|Q6IP71|RALBB_XENLA | Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 | 8 | 168 | 2.0E-26 |
| sp|Q92963|RIT1_HUMAN | GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 | 4 | 173 | 2.0E-26 |
| sp|P34143|RABC_DICDI | Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 | 8 | 183 | 3.0E-26 |
| sp|Q8BU31|RAP2C_MOUSE | Ras-related protein Rap-2c OS=Mus musculus GN=Rap2c PE=1 SV=1 | 19 | 174 | 4.0E-26 |
| sp|Q9Y3L5|RAP2C_HUMAN | Ras-related protein Rap-2c OS=Homo sapiens GN=RAP2C PE=1 SV=1 | 19 | 174 | 4.0E-26 |
| sp|Q08DI5|RAP2C_BOVIN | Ras-related protein Rap-2c OS=Bos taurus GN=RAP2C PE=2 SV=1 | 19 | 174 | 4.0E-26 |
| sp|O42277|RASK_ORYLA | GTPase KRas OS=Oryzias latipes GN=kras1 PE=2 SV=1 | 19 | 170 | 4.0E-26 |
| sp|P79800|RASK_MELGA | GTPase KRas OS=Meleagris gallopavo GN=KRAS PE=2 SV=1 | 19 | 170 | 5.0E-26 |
| sp|P08644|RASK_RAT | GTPase KRas OS=Rattus norvegicus GN=Kras PE=1 SV=3 | 19 | 170 | 6.0E-26 |
| sp|P32883|RASK_MOUSE | GTPase KRas OS=Mus musculus GN=Kras PE=1 SV=1 | 19 | 170 | 6.0E-26 |
| sp|Q9YH38|RASK_CYPCA | GTPase KRas OS=Cyprinus carpio GN=kras PE=2 SV=1 | 19 | 170 | 6.0E-26 |
| sp|P20171|RASH_RAT | GTPase HRas OS=Rattus norvegicus GN=Hras PE=1 SV=2 | 19 | 182 | 8.0E-26 |
| sp|Q61411|RASH_MOUSE | GTPase HRas OS=Mus musculus GN=Hras PE=1 SV=2 | 19 | 182 | 8.0E-26 |
| sp|P01112|RASH_HUMAN | GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1 | 19 | 182 | 8.0E-26 |
| sp|P70425|RIT2_MOUSE | GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 | 4 | 173 | 8.0E-26 |
| sp|P05774|RAS_CARAU | Ras-like protein (Fragment) OS=Carassius auratus PE=3 SV=1 | 19 | 170 | 9.0E-26 |
| sp|P01116|RASK_HUMAN | GTPase KRas OS=Homo sapiens GN=KRAS PE=1 SV=1 | 19 | 170 | 9.0E-26 |
| sp|Q5BJQ5|RIT2_RAT | GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 | 4 | 173 | 1.0E-25 |
| sp|P08642|RASH_CHICK | GTPase HRas OS=Gallus gallus GN=HRAS PE=1 SV=1 | 19 | 182 | 1.0E-25 |
| sp|Q5EFX7|RASK_KRYMA | GTPase KRas OS=Kryptolebias marmoratus GN=kras PE=2 SV=1 | 19 | 170 | 1.0E-25 |
| sp|P10833|RRAS_MOUSE | Ras-related protein R-Ras OS=Mus musculus GN=Rras PE=1 SV=1 | 19 | 183 | 2.0E-25 |
| sp|P01119|RAS1_YEAST | Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 | 5 | 165 | 2.0E-25 |
| sp|P38976|RAS2_HYDVU | Ras-like protein RAS2 OS=Hydra vulgaris GN=RAS2 PE=2 SV=1 | 5 | 178 | 3.0E-25 |
| sp|P51539|RAS1_HYDVU | Ras-like protein RAS1 OS=Hydra vulgaris GN=RAS1 PE=2 SV=2 | 19 | 181 | 3.0E-25 |
| sp|Q05147|RASK_XENLA | GTPase KRas OS=Xenopus laevis GN=kras PE=2 SV=1 | 19 | 170 | 4.0E-25 |
| sp|D3Z8L7|RRAS_RAT | Ras-related protein R-Ras OS=Rattus norvegicus GN=Rras PE=1 SV=1 | 19 | 180 | 7.0E-25 |
| sp|Q5F352|RASN_CHICK | GTPase NRas OS=Gallus gallus GN=NRAS PE=2 SV=1 | 19 | 170 | 8.0E-25 |
| sp|Q07983|RASK_MONDO | GTPase KRas OS=Monodelphis domestica GN=KRAS PE=1 SV=1 | 19 | 170 | 8.0E-25 |
| sp|Q01890|YPT1_PHYIN | Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 | 8 | 182 | 8.0E-25 |
| sp|P01120|RAS2_YEAST | Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 | 19 | 164 | 1.0E-24 |
| sp|B4KB60|RAS1_DROMO | Ras-like protein 1 OS=Drosophila mojavensis GN=Ras85D PE=3 SV=1 | 19 | 182 | 1.0E-24 |
| sp|P12825|RASN_CAVPO | GTPase NRas OS=Cavia porcellus GN=NRAS PE=2 SV=1 | 19 | 170 | 1.0E-24 |
| sp|Q2MJK3|RASN_PIG | GTPase NRas OS=Sus scrofa GN=NRAS PE=2 SV=1 | 19 | 170 | 1.0E-24 |
| sp|P08556|RASN_MOUSE | GTPase NRas OS=Mus musculus GN=Nras PE=1 SV=1 | 19 | 170 | 1.0E-24 |
| sp|P01111|RASN_HUMAN | GTPase NRas OS=Homo sapiens GN=NRAS PE=1 SV=1 | 19 | 170 | 1.0E-24 |
| sp|Q91806|RASN_XENLA | GTPase NRas OS=Xenopus laevis GN=nras PE=2 SV=1 | 19 | 170 | 2.0E-24 |
| sp|Q04970|RASN_RAT | GTPase NRas OS=Rattus norvegicus GN=Nras PE=1 SV=1 | 19 | 170 | 2.0E-24 |
| sp|O76173|RAB1C_DICDI | Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 | 8 | 180 | 2.0E-24 |
| sp|Q95ME4|RASN_MONDO | GTPase NRas OS=Monodelphis domestica GN=NRAS PE=2 SV=1 | 19 | 170 | 2.0E-24 |
| sp|P22981|LET60_CAEEL | Ras protein let-60 OS=Caenorhabditis elegans GN=let-60 PE=1 SV=1 | 19 | 186 | 3.0E-24 |
| sp|P79737|RASN_DANRE | GTPase NRas OS=Danio rerio GN=nras PE=2 SV=1 | 19 | 183 | 5.0E-24 |
| sp|Q5RD87|RASN_PONAB | GTPase NRas OS=Pongo abelii GN=NRAS PE=2 SV=1 | 19 | 170 | 6.0E-24 |
| sp|P10114|RAP2A_HUMAN | Ras-related protein Rap-2a OS=Homo sapiens GN=RAP2A PE=1 SV=1 | 19 | 185 | 9.0E-24 |
| sp|P52498|RSR1_CANAX | Ras-related protein RSR1 OS=Candida albicans GN=RSR1 PE=3 SV=1 | 19 | 172 | 1.0E-23 |
| sp|Q92928|RAB1C_HUMAN | Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 | 8 | 177 | 1.0E-23 |
| sp|P04388|RAS2_DROME | Ras-like protein 2 OS=Drosophila melanogaster GN=Ras64B PE=1 SV=2 | 19 | 172 | 3.0E-23 |
| sp|P17609|YPT2_SCHPO | GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 | 8 | 172 | 4.0E-23 |
| sp|Q4R8X3|RAB1B_MACFA | Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 | 8 | 177 | 6.0E-23 |
| sp|Q9TVU5|RAB1_THEPA | Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 | 8 | 178 | 6.0E-23 |
| sp|Q9D1G1|RAB1B_MOUSE | Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 | 8 | 177 | 6.0E-23 |
| sp|Q9ZRE2|RABD1_ARATH | Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 | 8 | 170 | 7.0E-23 |
| sp|Q5RE13|RAB1B_PONAB | Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 | 8 | 177 | 7.0E-23 |
| sp|Q9H0U4|RAB1B_HUMAN | Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 | 8 | 177 | 7.0E-23 |
| sp|Q2HJH2|RAB1B_BOVIN | Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 | 8 | 177 | 7.0E-23 |
| sp|P10536|RAB1B_RAT | Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 | 8 | 177 | 7.0E-23 |
| sp|Q96A58|RERG_HUMAN | Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1 | 1 | 172 | 8.0E-23 |
| sp|Q0VCJ7|RERG_BOVIN | Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 | 1 | 172 | 1.0E-22 |
| sp|Q8R367|RERG_MOUSE | Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 | 1 | 172 | 2.0E-22 |
| sp|P22125|RAB1_DIPOM | Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 | 8 | 175 | 3.0E-22 |
| sp|Q9FPJ4|RAD2B_ARATH | Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 | 8 | 183 | 3.0E-22 |
| sp|P35276|RAB3D_MOUSE | Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 | 8 | 182 | 5.0E-22 |
| sp|Q06AU7|RAB1B_PIG | Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 | 8 | 177 | 5.0E-22 |
| sp|Q63942|RAB3D_RAT | GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 | 8 | 182 | 6.0E-22 |
| sp|P11023|RAB3A_BOVIN | Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 | 8 | 165 | 6.0E-22 |
| sp|Q6NYB7|RAB1A_RAT | Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 | 8 | 175 | 7.0E-22 |
| sp|P62821|RAB1A_MOUSE | Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 | 8 | 175 | 7.0E-22 |
| sp|P62820|RAB1A_HUMAN | Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 | 8 | 175 | 7.0E-22 |
| sp|P62822|RAB1A_CANLF | Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 | 8 | 175 | 7.0E-22 |
| sp|P63012|RAB3A_RAT | Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 | 8 | 165 | 7.0E-22 |
| sp|Q06AU3|RAB3A_PIG | Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 | 8 | 165 | 7.0E-22 |
| sp|P63011|RAB3A_MOUSE | Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 | 8 | 165 | 7.0E-22 |
| sp|Q4R4R9|RAB3A_MACFA | Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 | 8 | 165 | 7.0E-22 |
| sp|P20336|RAB3A_HUMAN | Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 | 8 | 165 | 7.0E-22 |
| sp|Q52NJ2|RAB1A_PIG | Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 | 8 | 175 | 8.0E-22 |
| sp|P0CY30|SEC4_CANAX | Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 | 8 | 170 | 9.0E-22 |
| sp|C4YL11|SEC4_CANAW | Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 | 8 | 170 | 9.0E-22 |
| sp|P0CY31|SEC4_CANAL | Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 | 8 | 170 | 9.0E-22 |
| sp|P40392|RIC1_ORYSJ | Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 | 8 | 169 | 9.0E-22 |
| sp|Q9SEH3|RAD2C_ARATH | Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 | 8 | 169 | 1.0E-21 |
| sp|O95716|RAB3D_HUMAN | Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 | 8 | 173 | 1.0E-21 |
| sp|P28186|RAE1C_ARATH | Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 | 8 | 183 | 1.0E-21 |
| sp|P10948|RAB3B_BOVIN | Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 | 8 | 168 | 1.0E-21 |
| sp|Q9CZT8|RAB3B_MOUSE | Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 | 8 | 168 | 1.0E-21 |
| sp|Q5KTJ7|RAB3B_MESAU | Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 | 8 | 168 | 2.0E-21 |
| sp|P16976|YPTM1_MAIZE | GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 | 8 | 178 | 2.0E-21 |
| sp|P20337|RAB3B_HUMAN | Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 | 8 | 168 | 2.0E-21 |
| sp|Q4UB16|RAB1_THEAN | Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 | 8 | 178 | 2.0E-21 |
| sp|Q63941|RAB3B_RAT | Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 | 8 | 168 | 2.0E-21 |
| sp|Q24192|RHOL_DROME | Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 | 3 | 186 | 4.0E-21 |
| sp|Q9H0T7|RAB17_HUMAN | Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 | 8 | 177 | 5.0E-21 |
| sp|Q05974|RAB1A_LYMST | Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 | 8 | 181 | 6.0E-21 |
| sp|Q55BW0|RAPC_DICDI | Ras-related protein rapC OS=Dictyostelium discoideum GN=rapC PE=3 SV=1 | 8 | 172 | 6.0E-21 |
| sp|O24466|RAE1A_ARATH | Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 | 8 | 177 | 9.0E-21 |
| sp|P34139|RAB1A_DICDI | Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 | 8 | 169 | 1.0E-20 |
| sp|P25228|RAB3_DROME | Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 | 8 | 165 | 1.0E-20 |
| sp|P62824|RAB3C_RAT | Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 | 8 | 165 | 1.0E-20 |
| sp|P62823|RAB3C_MOUSE | Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 | 8 | 165 | 1.0E-20 |
| sp|Q94986|RAB3_CAEEL | Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 | 8 | 165 | 2.0E-20 |
| sp|P35292|RAB17_MOUSE | Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 | 8 | 176 | 2.0E-20 |
| sp|Q39433|RB1BV_BETVU | Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 | 8 | 181 | 2.0E-20 |
| sp|Q05737|YPTM2_MAIZE | GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 | 8 | 169 | 2.0E-20 |
| sp|P10949|RAB3C_BOVIN | Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 | 8 | 165 | 2.0E-20 |
| sp|P36861|YPTV2_VOLCA | GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 | 8 | 161 | 2.0E-20 |
| sp|O95057|DIRA1_HUMAN | GTP-binding protein Di-Ras1 OS=Homo sapiens GN=DIRAS1 PE=1 SV=1 | 19 | 182 | 2.0E-20 |
| sp|Q96E17|RAB3C_HUMAN | Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 | 8 | 165 | 2.0E-20 |
| sp|A4FV54|RAB8A_BOVIN | Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 | 8 | 181 | 3.0E-20 |
| sp|Q4R5P1|RAB8A_MACFA | Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 | 8 | 181 | 3.0E-20 |
| sp|P61006|RAB8A_HUMAN | Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 | 8 | 181 | 3.0E-20 |
| sp|P61007|RAB8A_CANLF | Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 | 8 | 181 | 3.0E-20 |
| sp|Q5R4A3|RAB8A_PONAB | Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 | 8 | 181 | 4.0E-20 |
| sp|P35280|RAB8A_RAT | Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 | 8 | 181 | 4.0E-20 |
| sp|P55258|RAB8A_MOUSE | Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 | 8 | 181 | 4.0E-20 |
| sp|P33723|YPT1_NEUCR | GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 | 8 | 170 | 4.0E-20 |
| sp|P34140|RAB1B_DICDI | Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 | 8 | 172 | 4.0E-20 |
| sp|Q91Z61|DIRA1_MOUSE | GTP-binding protein Di-Ras1 OS=Mus musculus GN=Diras1 PE=1 SV=1 | 19 | 171 | 5.0E-20 |
| sp|A1DZY4|RSLBL_DANRE | Ras-like protein family member 11A-like OS=Danio rerio GN=zgc:110179 PE=2 SV=1 | 4 | 182 | 5.0E-20 |
| sp|P28188|RAD2A_ARATH | Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 | 8 | 183 | 6.0E-20 |
| sp|O14807|RASM_HUMAN | Ras-related protein M-Ras OS=Homo sapiens GN=MRAS PE=1 SV=2 | 19 | 170 | 7.0E-20 |
| sp|Q39571|YPTC1_CHLRE | GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 | 8 | 182 | 7.0E-20 |
| sp|O49841|RAC2A_ARATH | Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 | 8 | 168 | 8.0E-20 |
| sp|Q5F470|RAB8A_CHICK | Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 | 8 | 181 | 9.0E-20 |
| sp|P01123|YPT1_YEAST | GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 | 8 | 180 | 1.0E-19 |
| sp|Q9Y272|RASD1_HUMAN | Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens GN=RASD1 PE=1 SV=1 | 1 | 166 | 1.0E-19 |
| sp|P20791|RAB8B_DICDI | Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 | 8 | 183 | 2.0E-19 |
| sp|Q5U316|RAB35_RAT | Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 | 8 | 178 | 2.0E-19 |
| sp|Q6PHN9|RAB35_MOUSE | Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 | 8 | 178 | 2.0E-19 |
| sp|Q15286|RAB35_HUMAN | Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 | 8 | 178 | 2.0E-19 |
| sp|P97538|RASM_RAT | Ras-related protein M-Ras OS=Rattus norvegicus GN=Mras PE=1 SV=2 | 19 | 152 | 2.0E-19 |
| sp|O08989|RASM_MOUSE | Ras-related protein M-Ras OS=Mus musculus GN=Mras PE=1 SV=1 | 19 | 152 | 2.0E-19 |
| sp|P11620|YPT1_SCHPO | GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 | 8 | 170 | 2.0E-19 |
| sp|Q40723|RLGP2_ORYSJ | Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 | 8 | 168 | 3.0E-19 |
| sp|P41924|RYL1_YARLI | Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 | 8 | 185 | 4.0E-19 |
| sp|P36862|YPTV3_VOLCA | GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 | 8 | 168 | 5.0E-19 |
| sp|O35626|RASD1_MOUSE | Dexamethasone-induced Ras-related protein 1 OS=Mus musculus GN=Rasd1 PE=1 SV=1 | 1 | 166 | 5.0E-19 |
| sp|Q9JKF8|RASD1_RAT | Dexamethasone-induced Ras-related protein 1 OS=Rattus norvegicus GN=Rasd1 PE=1 SV=1 | 1 | 166 | 5.0E-19 |
| sp|P31584|YPTV1_VOLCA | GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 | 8 | 169 | 6.0E-19 |
| sp|Q9SIP0|RAA5D_ARATH | Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 | 8 | 168 | 7.0E-19 |
| sp|Q2HJI8|RAB8B_BOVIN | Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 | 8 | 173 | 7.0E-19 |
| sp|P63033|RHES_RAT | GTP-binding protein Rhes OS=Rattus norvegicus GN=Rasd2 PE=1 SV=1 | 1 | 175 | 1.0E-18 |
| sp|P63032|RHES_MOUSE | GTP-binding protein Rhes OS=Mus musculus GN=Rasd2 PE=2 SV=1 | 1 | 175 | 1.0E-18 |
| sp|Q5FVY2|RSLBB_XENTR | Ras-like protein family member 11B OS=Xenopus tropicalis GN=rasl11b PE=2 SV=1 | 8 | 175 | 1.0E-18 |
| sp|P07560|SEC4_YEAST | Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 | 8 | 170 | 1.0E-18 |
| sp|Q9BPW5|RSLBB_HUMAN | Ras-like protein family member 11B OS=Homo sapiens GN=RASL11B PE=2 SV=1 | 8 | 180 | 1.0E-18 |
| sp|Q96S79|RSLAB_HUMAN | Ras-like protein family member 10B OS=Homo sapiens GN=RASL10B PE=2 SV=1 | 8 | 168 | 1.0E-18 |
| sp|Q9LS94|RAG3F_ARATH | Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 | 1 | 171 | 1.0E-18 |
| sp|Q5SSG5|RSLAB_MOUSE | Ras-like protein family member 10B OS=Mus musculus GN=Rasl10b PE=1 SV=1 | 8 | 168 | 1.0E-18 |
| sp|Q96D21|RHES_HUMAN | GTP-binding protein Rhes OS=Homo sapiens GN=RASD2 PE=1 SV=1 | 1 | 175 | 2.0E-18 |
| sp|Q9FGK5|RAA5A_ARATH | Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 | 8 | 168 | 2.0E-18 |
| sp|Q39434|RB2BV_BETVU | Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 | 8 | 168 | 2.0E-18 |
| sp|Q5REC9|RAB8B_PONAB | Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 | 8 | 182 | 2.0E-18 |
| sp|Q6P0U3|RSLBB_DANRE | Ras-like protein family member 11B OS=Danio rerio GN=rasl11b PE=2 SV=1 | 2 | 172 | 2.0E-18 |
| sp|Q92930|RAB8B_HUMAN | Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 | 8 | 182 | 2.0E-18 |
| sp|P20790|RAB8A_DICDI | Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 | 8 | 179 | 2.0E-18 |
| sp|Q54GY8|RAB18_DICDI | Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 | 1 | 168 | 2.0E-18 |
| sp|P36412|RB11A_DICDI | Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 | 8 | 168 | 2.0E-18 |
| sp|P70550|RAB8B_RAT | Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 | 8 | 173 | 2.0E-18 |
| sp|P61028|RAB8B_MOUSE | Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 | 8 | 173 | 2.0E-18 |
| sp|Q9LNK1|RABA3_ARATH | Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 | 8 | 168 | 2.0E-18 |
| sp|O42819|SEC4_CANGA | Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 | 8 | 170 | 3.0E-18 |
| sp|Q8AVS6|RSLBB_XENLA | Ras-like protein family member 11B OS=Xenopus laevis GN=rasl11b PE=2 SV=1 | 8 | 180 | 3.0E-18 |
| sp|Q9SRS5|RAA5B_ARATH | Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 | 8 | 168 | 3.0E-18 |
| sp|P34141|RABA_DICDI | Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 | 8 | 170 | 3.0E-18 |
| sp|Q5E9J3|RSLBB_BOVIN | Ras-like protein family member 11B OS=Bos taurus GN=RASL11B PE=2 SV=1 | 8 | 180 | 3.0E-18 |
| sp|P35284|RAB12_RAT | Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 | 2 | 170 | 4.0E-18 |
| sp|P35283|RAB12_MOUSE | Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 | 2 | 170 | 4.0E-18 |
| sp|Q0WQN4|RAA6B_ARATH | Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 | 8 | 168 | 4.0E-18 |
| sp|Q9SMQ6|RAA4B_ARATH | Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 | 8 | 173 | 5.0E-18 |
| sp|P38555|YPT31_YEAST | GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 | 8 | 168 | 5.0E-18 |
| sp|P28187|RAA5C_ARATH | Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 | 8 | 168 | 5.0E-18 |
| sp|P51152|RAB12_CANLF | Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 | 2 | 170 | 5.0E-18 |
| sp|P61589|RHOA_RAT | Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 | 6 | 186 | 5.0E-18 |
| sp|Q9QUI0|RHOA_MOUSE | Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 | 6 | 186 | 5.0E-18 |
| sp|Q6IQ22|RAB12_HUMAN | Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 | 2 | 170 | 5.0E-18 |
| sp|Q9PSX7|RHOC_CHICK | Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 | 6 | 186 | 6.0E-18 |
| sp|P22127|RAB10_DIPOM | Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 | 8 | 185 | 6.0E-18 |
| sp|Q9S810|RAA1I_ARATH | Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 | 8 | 178 | 7.0E-18 |
| sp|Q9LNW1|RAA2B_ARATH | Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 | 8 | 168 | 8.0E-18 |
| sp|Q40193|RB11C_LOTJA | Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 | 8 | 168 | 8.0E-18 |
| sp|Q5REY6|RHOA_PONAB | Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 | 6 | 186 | 8.0E-18 |
| sp|P61586|RHOA_HUMAN | Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 | 6 | 186 | 8.0E-18 |
| sp|P61585|RHOA_BOVIN | Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 | 6 | 186 | 8.0E-18 |
| sp|Q7T3A4|RAB13_DANRE | Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 | 8 | 178 | 9.0E-18 |
| sp|Q7T2E8|RHOAC_DANRE | Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 | 6 | 186 | 1.0E-17 |
| sp|P31022|RAB7_PEA | Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 | 1 | 171 | 1.0E-17 |
| sp|Q9FIF9|RAA2D_ARATH | Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 | 8 | 168 | 1.0E-17 |
| sp|Q9DD03|RAB13_MOUSE | Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 | 8 | 168 | 1.0E-17 |
| sp|Q86JP3|RAB5A_DICDI | Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 | 6 | 171 | 1.0E-17 |
| sp|P19892|RAA5E_ARATH | Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 | 8 | 168 | 1.0E-17 |
| sp|Q922H7|RSLBB_MOUSE | Ras-like protein family member 11B OS=Mus musculus GN=Rasl11b PE=2 SV=1 | 8 | 180 | 1.0E-17 |
| sp|Q9FJH0|RAA1F_ARATH | Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 | 8 | 178 | 1.0E-17 |
| sp|Q550H6|RB11C_DICDI | Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 | 8 | 168 | 1.0E-17 |
| sp|P90726|RAB18_CAEBR | Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 | 8 | 176 | 2.0E-17 |
| sp|Q99260|YPT6_YEAST | GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 | 8 | 181 | 2.0E-17 |
| sp|Q6DHC1|RB18B_DANRE | Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 | 8 | 175 | 2.0E-17 |
| sp|Q9ULC3|RAB23_HUMAN | Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 | 8 | 164 | 2.0E-17 |
| sp|Q9C9U7|RAA6A_ARATH | Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 | 8 | 168 | 2.0E-17 |
| sp|P48148|RHO1_DROME | Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 | 3 | 162 | 2.0E-17 |
| sp|Q8MXS1|RAB18_CAEEL | Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 | 8 | 181 | 2.0E-17 |
| sp|Q9C3Y4|RHOA_EMENI | GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 | 6 | 162 | 2.0E-17 |
| sp|Q9GPS3|RACF2_DICDI | Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1 | 8 | 186 | 3.0E-17 |
| sp|Q39222|RAA1B_ARATH | Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 | 8 | 168 | 3.0E-17 |
| sp|P51153|RAB13_HUMAN | Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 | 8 | 168 | 3.0E-17 |
| sp|Q58DS5|RAB13_BOVIN | Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 | 8 | 168 | 3.0E-17 |
| sp|Q9SF92|RAC2B_ARATH | Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 | 8 | 168 | 3.0E-17 |
| sp|P24409|RAB10_CANLF | Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 | 8 | 185 | 3.0E-17 |
| sp|Q1PEX3|RAA1H_ARATH | Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 | 8 | 178 | 3.0E-17 |
| sp|Q6NUX8|RHOAA_DANRE | Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 | 6 | 186 | 3.0E-17 |
| sp|Q5ZLG1|RAB18_CHICK | Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 | 8 | 175 | 3.0E-17 |
| sp|Q8MYF2|RABJ_DICDI | Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 | 6 | 161 | 3.0E-17 |
| sp|P23640|RB27A_RAT | Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 | 8 | 170 | 3.0E-17 |
| sp|Q5R5U1|RAB10_PONAB | Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 | 8 | 185 | 4.0E-17 |
| sp|P61027|RAB10_MOUSE | Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 | 8 | 185 | 4.0E-17 |
| sp|P61026|RAB10_HUMAN | Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 | 8 | 185 | 4.0E-17 |
| sp|P35286|RAB13_RAT | Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 | 8 | 185 | 4.0E-17 |
| sp|Q5R5H5|RAB18_PONAB | Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 | 8 | 175 | 4.0E-17 |
| sp|Q9NP72|RAB18_HUMAN | Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 | 8 | 175 | 4.0E-17 |
| sp|Q0IIG8|RAB18_BOVIN | Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 | 8 | 175 | 4.0E-17 |
| sp|P35293|RAB18_MOUSE | Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 | 8 | 175 | 4.0E-17 |
| sp|P22128|RAB8_DIPOM | Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 | 8 | 174 | 4.0E-17 |
| sp|Q5EB77|RAB18_RAT | Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 | 8 | 175 | 5.0E-17 |
| sp|Q558I0|RABF1_DICDI | Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 | 8 | 185 | 5.0E-17 |
| sp|Q9XI98|RAG3E_ARATH | Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 | 1 | 171 | 5.0E-17 |
| sp|Q9XGU0|RAC9_ARATH | Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 | 8 | 162 | 5.0E-17 |
| sp|O35963|RB33B_MOUSE | Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 | 1 | 174 | 5.0E-17 |
| sp|P24406|RHOA_CANLF | Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 | 6 | 186 | 5.0E-17 |
| sp|Q54NU2|RAB1D_DICDI | Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 | 8 | 181 | 5.0E-17 |
| sp|Q1ZXE7|RABZ_DICDI | Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 | 9 | 174 | 5.0E-17 |
| sp|Q96283|RAA2C_ARATH | Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 | 8 | 168 | 5.0E-17 |
| sp|Q5KTJ6|RAB13_MESAU | Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 | 8 | 168 | 5.0E-17 |
| sp|P35288|RAB23_MOUSE | Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 | 8 | 164 | 5.0E-17 |
| sp|Q9ERI2|RB27A_MOUSE | Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 | 8 | 170 | 5.0E-17 |
| sp|Q5ZIT5|RAB10_CHICK | Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 | 8 | 185 | 6.0E-17 |
| sp|O04486|RAA2A_ARATH | Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 | 8 | 168 | 7.0E-17 |
| sp|P35281|RAB10_RAT | Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 | 8 | 185 | 7.0E-17 |
| sp|Q9CB01|RABF1_ARATH | Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 | 8 | 162 | 7.0E-17 |
| sp|O35509|RB11B_RAT | Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 | 8 | 168 | 7.0E-17 |
| sp|Q15907|RB11B_HUMAN | Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 | 8 | 168 | 7.0E-17 |
| sp|Q3MHP2|RB11B_BOVIN | Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 | 8 | 168 | 7.0E-17 |
| sp|Q5ZJN2|RB11A_CHICK | Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 | 8 | 168 | 7.0E-17 |
| sp|Q9HF56|CDC42_ASHGO | Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 | 8 | 169 | 7.0E-17 |
| sp|P46638|RB11B_MOUSE | Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 | 8 | 168 | 7.0E-17 |
| sp|Q9H082|RB33B_HUMAN | Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 | 1 | 174 | 7.0E-17 |
| sp|Q40195|RB11E_LOTJA | Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 | 8 | 181 | 8.0E-17 |
| sp|P62494|RB11A_RAT | Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 | 8 | 168 | 8.0E-17 |
| sp|P62493|RB11A_RABIT | Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 | 8 | 168 | 8.0E-17 |
| sp|Q5R9M7|RB11A_PONAB | Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 | 8 | 168 | 8.0E-17 |
| sp|Q52NJ1|RB11A_PIG | Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 | 8 | 168 | 8.0E-17 |
| sp|P62492|RB11A_MOUSE | Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 | 8 | 168 | 8.0E-17 |
| sp|P62491|RB11A_HUMAN | Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 | 8 | 168 | 8.0E-17 |
| sp|P62490|RB11A_CANLF | Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 | 8 | 168 | 8.0E-17 |
| sp|F1PTE3|RAB13_CANLF | Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 | 8 | 178 | 8.0E-17 |
| sp|P22129|RB11B_DIPOM | Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 | 8 | 168 | 8.0E-17 |
| sp|Q5R615|RB33B_PONAB | Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 | 1 | 174 | 8.0E-17 |
| sp|Q22038|RHO1_CAEEL | Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 | 6 | 162 | 9.0E-17 |
| sp|Q40787|RAB7_CENCI | Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 | 8 | 172 | 9.0E-17 |
| sp|Q5RCK9|RHOC_PONAB | Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 | 6 | 186 | 1.0E-16 |
| sp|Q62159|RHOC_MOUSE | Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 | 6 | 186 | 1.0E-16 |
| sp|P08134|RHOC_HUMAN | Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 | 6 | 186 | 1.0E-16 |
| sp|Q1RMJ6|RHOC_BOVIN | Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 | 6 | 186 | 1.0E-16 |
| sp|Q6DHE8|RHOAD_DANRE | Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 | 6 | 186 | 1.0E-16 |
| sp|P35282|RAB21_MOUSE | Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 | 8 | 172 | 1.0E-16 |
| sp|P01122|RHO_APLCA | Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 | 6 | 162 | 1.0E-16 |
| sp|Q6AXT5|RAB21_RAT | Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 | 8 | 172 | 1.0E-16 |
| sp|Q17R06|RAB21_BOVIN | Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 | 8 | 172 | 1.0E-16 |
| sp|O96390|RACF1_DICDI | Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1 | 8 | 186 | 2.0E-16 |
| sp|Q9UL25|RAB21_HUMAN | Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 | 8 | 172 | 2.0E-16 |
| sp|P40393|RIC2_ORYSJ | Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 | 8 | 180 | 2.0E-16 |
| sp|P55745|RAB21_CANLF | Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 | 8 | 172 | 2.0E-16 |
| sp|Q8VEA8|RAB7B_MOUSE | Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 | 8 | 167 | 2.0E-16 |
| sp|Q2TA29|RB11A_BOVIN | Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 | 8 | 168 | 2.0E-16 |
| sp|O00212|RHOD_HUMAN | Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 | 2 | 162 | 2.0E-16 |
| sp|Q1KME6|RAB6A_CHICK | Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 | 8 | 185 | 2.0E-16 |
| sp|Q39572|YPTC6_CHLRE | Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 | 8 | 168 | 2.0E-16 |
| sp|Q9LK99|RAA1G_ARATH | Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 | 8 | 176 | 3.0E-16 |
| sp|Q1HE58|RB27A_CANLF | Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 | 8 | 170 | 3.0E-16 |
| sp|Q40191|RB11A_LOTJA | Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 | 8 | 186 | 3.0E-16 |
| sp|P34147|RACA_DICDI | Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 | 8 | 182 | 3.0E-16 |
| sp|Q9SF91|RAE1E_ARATH | Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 | 8 | 176 | 3.0E-16 |
| sp|P32939|YPT7_YEAST | GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 | 1 | 176 | 5.0E-16 |
| sp|Q29HY3|CDC42_DROPS | Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 | 8 | 186 | 5.0E-16 |
| sp|C4YDI6|CDC42_CANAW | Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 | 8 | 169 | 5.0E-16 |
| sp|P0CY33|CDC42_CANAL | Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 | 8 | 169 | 5.0E-16 |
| sp|P51159|RB27A_HUMAN | Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 | 8 | 170 | 5.0E-16 |
| sp|Q4LE85|RB27A_PIG | Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 | 8 | 170 | 5.0E-16 |
| sp|Q16YG0|CDC42_AEDAE | Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 | 8 | 186 | 5.0E-16 |
| sp|Q9HE04|RHO5_SCHPO | GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 | 1 | 162 | 6.0E-16 |
| sp|P40793|CDC42_DROME | Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 | 8 | 186 | 6.0E-16 |
| sp|P25766|RLGP1_ORYSJ | Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 | 8 | 168 | 6.0E-16 |
| sp|Q6IMA7|RSLBB_RAT | Ras-like protein family member 11B OS=Rattus norvegicus GN=Rasl11b PE=2 SV=1 | 8 | 180 | 6.0E-16 |
| sp|Q09914|RHO1_SCHPO | GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 | 1 | 162 | 6.0E-16 |
| sp|Q08DE8|RAB7B_BOVIN | Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 | 8 | 167 | 7.0E-16 |
| sp|P36864|YPTV5_VOLCA | GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 | 3 | 164 | 7.0E-16 |
| sp|Q17031|CDC42_ANOGA | Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 | 8 | 186 | 8.0E-16 |
| sp|Q4R4R6|CDC42_MACFA | Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 | 8 | 181 | 8.0E-16 |
| sp|O82480|RAC7_ARATH | Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 | 1 | 185 | 9.0E-16 |
| sp|Q00246|RHO4_YEAST | GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 | 8 | 165 | 9.0E-16 |
| sp|O24461|RAB7_PRUAR | Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 | 8 | 164 | 9.0E-16 |
| sp|Q40521|RB11B_TOBAC | Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 | 8 | 178 | 9.0E-16 |
| sp|O49513|RAA1E_ARATH | Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 | 8 | 170 | 9.0E-16 |
| sp|Q5RAV6|RAB6A_PONAB | Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 | 8 | 185 | 9.0E-16 |
| sp|P20340|RAB6A_HUMAN | Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 | 8 | 185 | 9.0E-16 |
| sp|Q559X6|RAB2B_DICDI | Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 | 8 | 175 | 9.0E-16 |
| sp|Q96AH8|RAB7B_HUMAN | Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 | 8 | 167 | 9.0E-16 |
| sp|P35289|RAB15_RAT | Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 | 8 | 164 | 1.0E-15 |
| sp|Q9FJN8|RAA4A_ARATH | Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 | 8 | 168 | 1.0E-15 |
| sp|Q9WVB1|RAB6A_RAT | Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 | 8 | 185 | 1.0E-15 |
| sp|P35279|RAB6A_MOUSE | Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 | 8 | 185 | 1.0E-15 |
| sp|P97348|RHOD_MOUSE | Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 | 8 | 162 | 1.0E-15 |
| sp|Q17QU4|RB39B_BOVIN | Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 | 6 | 184 | 1.0E-15 |
| sp|P59190|RAB15_HUMAN | Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 | 8 | 164 | 1.0E-15 |
| sp|O23561|RAB1A_ARATH | Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 | 8 | 175 | 1.0E-15 |
| sp|Q54FL2|RABG2_DICDI | Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 | 8 | 178 | 1.0E-15 |
| sp|Q1RMR4|RAB15_BOVIN | Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 | 8 | 164 | 1.0E-15 |
| sp|O95661|DIRA3_HUMAN | GTP-binding protein Di-Ras3 OS=Homo sapiens GN=DIRAS3 PE=1 SV=1 | 19 | 180 | 1.0E-15 |
| sp|Q38922|RAB1B_ARATH | Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 | 8 | 175 | 1.0E-15 |
| sp|Q8K386|RAB15_MOUSE | Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 | 8 | 164 | 1.0E-15 |
| sp|Q38912|RAC3_ARATH | Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 | 1 | 165 | 1.0E-15 |
| sp|Q40194|RB11D_LOTJA | Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 | 8 | 182 | 1.0E-15 |
| sp|P19073|CDC42_YEAST | Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 | 8 | 169 | 1.0E-15 |
| sp|Q05062|CDC42_CAEEL | Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2 | 8 | 186 | 1.0E-15 |
| sp|P51996|YPT32_YEAST | GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 | 8 | 168 | 2.0E-15 |
| sp|Q99P75|RAB9A_RAT | Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 | 8 | 176 | 2.0E-15 |
| sp|Q5ZHV1|RB33B_CHICK | Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 | 1 | 174 | 2.0E-15 |
| sp|Q54KM9|RB11B_DICDI | Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 | 8 | 168 | 2.0E-15 |
| sp|Q08E00|RASLC_BOVIN | Ras-like protein family member 12 OS=Bos taurus GN=RASL12 PE=2 SV=1 | 9 | 161 | 2.0E-15 |
| sp|Q9C820|RAG3D_ARATH | Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 | 3 | 178 | 2.0E-15 |
| sp|P92963|RAB1C_ARATH | Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 | 8 | 175 | 2.0E-15 |
| sp|Q9SN35|RAA1D_ARATH | Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 | 8 | 180 | 2.0E-15 |
| sp|P36017|VPS21_YEAST | Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 | 8 | 161 | 2.0E-15 |
| sp|Q08AT1|RASLC_MOUSE | Ras-like protein family member 12 OS=Mus musculus GN=Rasl12 PE=2 SV=1 | 9 | 170 | 2.0E-15 |
| sp|Q9FK68|RAA1C_ARATH | Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 | 8 | 168 | 3.0E-15 |
| sp|P34213|RAB6A_CAEEL | Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 | 5 | 161 | 3.0E-15 |
| sp|O75628|REM1_HUMAN | GTP-binding protein REM 1 OS=Homo sapiens GN=REM1 PE=1 SV=2 | 8 | 162 | 3.0E-15 |
| sp|O42825|RHO1_CANAL | GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 | 2 | 162 | 3.0E-15 |
| sp|Q9XER8|RAB7_GOSHI | Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 | 8 | 172 | 3.0E-15 |
| sp|Q8CFN2|CDC42_RAT | Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 | 8 | 181 | 3.0E-15 |
| sp|Q007T2|CDC42_PIG | Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 | 8 | 181 | 3.0E-15 |
| sp|P60766|CDC42_MOUSE | Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 | 8 | 181 | 3.0E-15 |
| sp|P60953|CDC42_HUMAN | Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 | 8 | 181 | 3.0E-15 |
| sp|P60952|CDC42_CANLF | Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 | 8 | 181 | 3.0E-15 |
| sp|Q2KJ93|CDC42_BOVIN | Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 | 8 | 181 | 3.0E-15 |
| sp|Q05975|RAB2_LYMST | Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 | 8 | 161 | 3.0E-15 |
| sp|Q6IMB1|RSLBA_MOUSE | Ras-like protein family member 11A OS=Mus musculus GN=Rasl11a PE=1 SV=1 | 5 | 175 | 4.0E-15 |
| sp|Q7L0Q8|RHOU_HUMAN | Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 | 8 | 165 | 4.0E-15 |
| sp|Q90694|CDC42_CHICK | Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 | 8 | 172 | 4.0E-15 |
| sp|Q5R6B6|RAB2A_PONAB | Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 | 8 | 161 | 4.0E-15 |
| sp|Q4R4X6|RAB2A_MACFA | Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 | 8 | 161 | 4.0E-15 |
| sp|P61019|RAB2A_HUMAN | Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 | 8 | 161 | 4.0E-15 |
| sp|Q90965|RAB2A_CHICK | Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 | 8 | 161 | 4.0E-15 |
| sp|P61105|RAB2A_CANLF | Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 | 8 | 161 | 4.0E-15 |
| sp|Q9HBH0|RHOF_HUMAN | Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 | 2 | 173 | 4.0E-15 |
| sp|Q96DA2|RB39B_HUMAN | Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 | 6 | 184 | 4.0E-15 |
| sp|Q01971|RAB2A_RABIT | Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 | 8 | 161 | 4.0E-15 |
| sp|Q8BHC1|RB39B_MOUSE | Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 | 6 | 184 | 5.0E-15 |
| sp|Q9LZD4|RAE1D_ARATH | Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 | 8 | 176 | 5.0E-15 |
| sp|P53994|RAB2A_MOUSE | Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 | 8 | 161 | 5.0E-15 |
| sp|Q40523|RB11A_TOBAC | Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 | 8 | 168 | 5.0E-15 |
| sp|P61294|RAB6B_MOUSE | Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 | 5 | 185 | 5.0E-15 |
| sp|Q9NRW1|RAB6B_HUMAN | Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 | 5 | 185 | 5.0E-15 |
| sp|A6QR46|RAB6B_BOVIN | Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 | 5 | 185 | 5.0E-15 |
| sp|P93267|RAB7_MESCR | Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 | 1 | 164 | 6.0E-15 |
| sp|Q8HZJ5|RB27B_BOVIN | Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 | 8 | 170 | 6.0E-15 |
| sp|Q5R8Z8|RAB14_PONAB | Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 | 8 | 161 | 6.0E-15 |
| sp|Q91V41|RAB14_MOUSE | Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 | 8 | 161 | 6.0E-15 |
| sp|P61106|RAB14_HUMAN | Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 | 8 | 161 | 6.0E-15 |
| sp|Q5ZKU5|RAB14_CHICK | Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 | 8 | 161 | 6.0E-15 |
| sp|P84096|RHOG_MOUSE | Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 | 8 | 161 | 6.0E-15 |
| sp|P84095|RHOG_HUMAN | Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 | 8 | 161 | 6.0E-15 |
| sp|P84097|RHOG_CRICR | Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 | 8 | 161 | 6.0E-15 |
| sp|O23657|RABC1_ARATH | Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 | 8 | 168 | 6.0E-15 |
| sp|P49103|RAB2A_MAIZE | Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 | 8 | 161 | 6.0E-15 |
| sp|Q9R0M6|RAB9A_MOUSE | Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 | 8 | 173 | 6.0E-15 |
| sp|Q6IMA3|RSLBA_RAT | Ras-like protein family member 11A OS=Rattus norvegicus GN=Rasl11a PE=2 SV=2 | 5 | 170 | 6.0E-15 |
| sp|Q6DHM9|RHOAB_DANRE | Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 | 6 | 163 | 6.0E-15 |
| sp|P61107|RAB14_RAT | Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 | 8 | 161 | 6.0E-15 |
| sp|Q52NJ6|RAB14_PIG | Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 | 8 | 161 | 6.0E-15 |
| sp|P28185|RAA1A_ARATH | Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 | 8 | 170 | 6.0E-15 |
| sp|Q05976|RB18A_LYMST | Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 | 13 | 175 | 7.0E-15 |
| sp|O35929|REM1_MOUSE | GTP-binding protein REM 1 OS=Mus musculus GN=Rem1 PE=1 SV=1 | 8 | 179 | 7.0E-15 |
| sp|P49104|RAB2B_MAIZE | Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 | 8 | 161 | 7.0E-15 |
| sp|Q921E2|RAB31_MOUSE | Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 | 3 | 182 | 8.0E-15 |
| sp|P36863|YPTV4_VOLCA | GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 | 8 | 161 | 8.0E-15 |
| sp|Q9EQT3|RHOU_MOUSE | Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 | 8 | 173 | 8.0E-15 |
| sp|P22122|RHO_DIPOM | Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 | 6 | 174 | 8.0E-15 |
| sp|Q6DGN0|RERGL_DANRE | Ras-related and estrogen-regulated growth inhibitor-like protein OS=Danio rerio GN=rergl PE=2 SV=1 | 8 | 180 | 9.0E-15 |
| sp|Q39570|YPTC4_CHLRE | GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 | 8 | 161 | 1.0E-14 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003924 | GTPase activity | Yes |
| GO:0005525 | GTP binding | Yes |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0000166 | nucleotide binding | No |
| GO:0043167 | ion binding | No |
| GO:0043168 | anion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0036094 | small molecule binding | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0003674 | molecular_function | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 30 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|7587 MPSTKQRKIAIVGSRSVGKSSLAVQYVDGHFVDSYYPTIENTFCKTIKFKGQDFATEIVDTAGQDEYSILNSKHF IGIHGYMLVYSVSSLPSFEMVQVIREKILNHLGAESVPIVIVGNKSDLRPEQRQVSPEEGKKLSETLQCGWTEAS ARYNEHVSRAFELLIAQIEKSQNPGDAPQKSGCDIM* |
| Coding | >OphauG2|7587 ATGCCTTCGACTAAGCAGAGAAAGATTGCCATCGTGGGCAGCAGGTCAGTTGGAAAATCGTCGTTGGCGGTGCAG TATGTCGACGGCCACTTTGTCGACAGCTACTATCCGACTATCGAGAATACGTTTTGCAAGACCATCAAATTCAAG GGCCAGGACTTTGCGACCGAGATTGTCGACACAGCAGGTCAGGATGAGTATAGCATCCTGAACTCCAAACACTTT ATCGGCATTCACGGCTATATGCTGGTCTACTCGGTTTCATCCTTGCCCTCCTTTGAGATGGTACAAGTCATTCGA GAGAAGATTCTCAATCACCTAGGAGCCGAGTCGGTTCCCATCGTTATCGTTGGCAACAAGAGCGACTTGAGACCC GAACAGCGCCAAGTCAGCCCCGAAGAGGGCAAGAAGTTGTCGGAAACGCTGCAGTGCGGATGGACCGAGGCTAGC GCACGGTACAATGAGCACGTCTCCCGCGCATTTGAGTTGCTCATTGCACAAATTGAAAAGTCTCAGAACCCGGGC GACGCTCCCCAGAAAAGCGGCTGCGATATCATGTGA |
| Transcript | >OphauG2|7587 ATGCCTTCGACTAAGCAGAGAAAGATTGCCATCGTGGGCAGCAGGTCAGTTGGAAAATCGTCGTTGGCGGTGCAG TATGTCGACGGCCACTTTGTCGACAGCTACTATCCGACTATCGAGAATACGTTTTGCAAGACCATCAAATTCAAG GGCCAGGACTTTGCGACCGAGATTGTCGACACAGCAGGTCAGGATGAGTATAGCATCCTGAACTCCAAACACTTT ATCGGCATTCACGGCTATATGCTGGTCTACTCGGTTTCATCCTTGCCCTCCTTTGAGATGGTACAAGTCATTCGA GAGAAGATTCTCAATCACCTAGGAGCCGAGTCGGTTCCCATCGTTATCGTTGGCAACAAGAGCGACTTGAGACCC GAACAGCGCCAAGTCAGCCCCGAAGAGGGCAAGAAGTTGTCGGAAACGCTGCAGTGCGGATGGACCGAGGCTAGC GCACGGTACAATGAGCACGTCTCCCGCGCATTTGAGTTGCTCATTGCACAAATTGAAAAGTCTCAGAACCCGGGC GACGCTCCCCAGAAAAGCGGCTGCGATATCATGTGA |
| Gene | >OphauG2|7587 ATGCCTTCGACTAAGCAGAGAAAGATTGCCATCGTGGGCAGCAGGTCAGTTGGTAAGTCAATATGCCCATGACAA GACTGCGACTTTATGGGGAAAGACGAAAGAGCCTAAAATAGGAAATCCCCTCTTATGAGACAAGAGACGAAATAT TCTGATGAAGATTCCTCCGCGATGCAGGAAAATCGTCGTTGGCGGTGCAGTATGTCGACGGCCACTTTGTCGACA GCTACTATCCGACTATCGAGAATACGTTTTGCAAGACCATCAAATTCAAGGGCCAGGACTTTGCGACCGAGATTG TCGACACAGCAGGTCAGGATGAGTATAGCATCCTGAACTCCAAACACTTTATCGGCATTCACGGCTATATGCTGG TCTACTCGGTTTCATCCTTGCCCTCCTTTGAGATGGTACAAGTCATTCGAGAGAAGATTCTCAATCACCTAGTGG GCGCCGTCCCCTTTCTTGCACATCATATCCACGGAGTCTAATCTGTCCAGGGAGCCGAGTCGGTTCCCATCGTTA TCGTTGGCAACAAGAGCGACTTGAGACCCGAACAGCGCCAAGTCAGCCCCGAAGAGGGCAAGAAGTTGTCGGAAA CGCTGCAGTGCGGATGGACCGAGGCTAGCGCACGGTACAATGAGCACGTCTCCCGCGCATTTGAGTTGCTCATTG CACAAATTGAAAAGTCTCAGAACCCGGGCGACGCTCCCCAGAAAAGCGGCTGCGATATCATGTGA |