Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7586
Gene name
LocationContig_9:64017..65962
Strand-
Gene length (bp)1945
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 1.2E-36 246 433
PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain 2.9E-18 23 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14018|SYSC_SCHPO Serine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29A4.15 PE=3 SV=1 23 471 0.0E+00
sp|Q9HGT6|SYSC_CANAL Serine--tRNA ligase, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SES1 PE=1 SV=1 23 470 0.0E+00
sp|P07284|SYSC_YEAST Serine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SES1 PE=1 SV=2 23 463 0.0E+00
sp|Q7KWQ2|SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=serS PE=1 SV=1 24 475 1.0E-179
sp|Q39230|SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g27470 PE=2 SV=1 23 471 4.0E-162
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14018|SYSC_SCHPO Serine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29A4.15 PE=3 SV=1 23 471 0.0E+00
sp|Q9HGT6|SYSC_CANAL Serine--tRNA ligase, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SES1 PE=1 SV=1 23 470 0.0E+00
sp|P07284|SYSC_YEAST Serine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SES1 PE=1 SV=2 23 463 0.0E+00
sp|Q7KWQ2|SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=serS PE=1 SV=1 24 475 1.0E-179
sp|Q39230|SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g27470 PE=2 SV=1 23 471 4.0E-162
sp|O81983|SYS_HELAN Serine--tRNA ligase OS=Helianthus annuus PE=2 SV=1 23 464 4.0E-162
sp|Q6P799|SYSC_RAT Serine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Sars PE=1 SV=3 23 480 1.0E-150
sp|P26638|SYSC_MOUSE Serine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Sars PE=1 SV=3 23 480 1.0E-148
sp|Q4R4U9|SYSC_MACFA Serine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=SARS PE=2 SV=3 23 480 8.0E-148
sp|Q9GMB8|SYSC_BOVIN Serine--tRNA ligase, cytoplasmic OS=Bos taurus GN=SARS PE=2 SV=3 23 480 4.0E-147
sp|Q5R9K9|SYSC_PONAB Serine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=SARS PE=2 SV=3 23 480 3.0E-146
sp|P49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=SARS PE=1 SV=3 23 480 3.0E-146
sp|Q18678|SYSC_CAEEL Probable serine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=srs-2 PE=3 SV=1 23 471 3.0E-142
sp|Q8SS48|SYS_ENCCU Serine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0750 PE=1 SV=1 38 451 8.0E-112
sp|Q2NEU9|SYS_METST Serine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=serS PE=3 SV=1 23 451 1.0E-101
sp|A9A4V3|SYS_NITMS Serine--tRNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=serS PE=3 SV=1 37 449 4.0E-95
sp|A0RTS8|SYS_CENSY Serine--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=serS PE=3 SV=1 25 449 2.0E-92
sp|C5A226|SYS_THEGJ Serine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=serS PE=3 SV=1 23 459 2.0E-91
sp|Q8U1K2|SYS_PYRFU Serine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=serS PE=3 SV=1 23 461 1.0E-90
sp|O28244|SYS_ARCFU Serine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serS PE=3 SV=1 23 449 5.0E-90
sp|Q5JE75|SYS_THEKO Serine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=serS PE=3 SV=1 23 457 6.0E-90
sp|O58441|SYS_PYRHO Serine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=serS PE=1 SV=2 23 460 2.0E-89
sp|A7I890|SYS_METB6 Serine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=serS PE=3 SV=1 25 449 1.0E-88
sp|B6YWW5|SYS_THEON Serine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=serS PE=3 SV=1 23 457 2.0E-88
sp|Q6KZN5|SYS_PICTO Serine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=serS PE=3 SV=1 36 448 6.0E-88
sp|Q9UZ21|SYS_PYRAB Serine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=serS PE=3 SV=1 23 460 7.0E-88
sp|Q9HKX5|SYS_THEAC Serine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=serS PE=3 SV=1 62 448 5.0E-87
sp|Q979Z3|SYS_THEVO Serine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=serS PE=3 SV=1 47 448 7.0E-87
sp|A3CTP4|SYS_METMJ Serine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=serS PE=3 SV=1 37 452 8.0E-87
sp|Q2FS27|SYS_METHJ Serine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=serS PE=3 SV=1 23 449 7.0E-86
sp|Q9ZBX1|SYS_STRCO Serine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=serS PE=3 SV=1 36 460 9.0E-86
sp|A2BM70|SYS_HYPBU Serine--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=serS PE=3 SV=1 36 453 3.0E-85
sp|B1L5G0|SYS_KORCO Serine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=serS PE=3 SV=1 36 449 3.0E-83
sp|Q0W8S5|SYS_METAR Serine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=serS PE=3 SV=1 23 451 3.0E-83
sp|A2SRC6|SYS_METLZ Serine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=serS PE=3 SV=1 23 451 4.0E-83
sp|Q82FK8|SYS1_STRAW Serine--tRNA ligase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=serS1 PE=3 SV=1 36 460 2.0E-82
sp|C5CGC3|SYS_KOSOT Serine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=serS PE=3 SV=1 36 449 3.0E-82
sp|Q4A172|SYS_STAS1 Serine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=serS PE=3 SV=1 23 451 4.0E-82
sp|A8AB67|SYS_IGNH4 Serine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=serS PE=3 SV=1 36 449 3.0E-81
sp|B9DPW5|SYS_STACT Serine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=serS PE=3 SV=1 23 460 1.0E-80
sp|C6A4A3|SYS_THESM Serine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=serS PE=3 SV=1 54 460 2.0E-80
sp|Q8CU95|SYS_STAES Serine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=serS PE=3 SV=1 23 451 5.0E-80
sp|Q5HK07|SYS_STAEQ Serine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=serS PE=3 SV=1 23 451 5.0E-80
sp|B1YGC4|SYS_EXIS2 Serine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=serS PE=3 SV=1 30 451 6.0E-80
sp|Q6GKT6|SYS_STAAR Serine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=serS PE=3 SV=1 23 451 7.0E-80
sp|Q970Y4|SYS_SULTO Serine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=serS PE=3 SV=1 35 465 1.0E-79
sp|A8YYT2|SYS_STAAT Serine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=serS PE=3 SV=1 23 451 1.0E-79
sp|A6QD48|SYS_STAAE Serine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=serS PE=3 SV=1 23 451 1.0E-79
sp|Q5HJY7|SYS_STAAC Serine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=serS PE=3 SV=1 23 451 1.0E-79
sp|P95689|SYS_STAA8 Serine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=serS PE=3 SV=1 23 451 1.0E-79
sp|Q2FKP7|SYS_STAA3 Serine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=serS PE=3 SV=1 23 451 1.0E-79
sp|Q252J5|SYS_DESHY Serine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=serS PE=3 SV=1 23 449 1.0E-79
sp|B1VP80|SYS_STRGG Serine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=serS PE=3 SV=1 36 460 1.0E-79
sp|P99178|SYS_STAAN Serine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=serS PE=1 SV=1 23 451 3.0E-79
sp|P61083|SYS_STAAM Serine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=serS PE=3 SV=1 23 451 3.0E-79
sp|A5INQ0|SYS_STAA9 Serine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=serS PE=3 SV=1 23 451 3.0E-79
sp|A6TXF9|SYS_STAA2 Serine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=serS PE=3 SV=1 23 451 3.0E-79
sp|A7WWP0|SYS_STAA1 Serine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=serS PE=3 SV=1 23 451 3.0E-79
sp|Q6GD81|SYS_STAAS Serine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=serS PE=3 SV=1 23 451 3.0E-79
sp|Q8NYY2|SYS_STAAW Serine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=serS PE=3 SV=1 23 451 4.0E-79
sp|B8FXX3|SYS_DESHD Serine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=serS PE=3 SV=1 23 449 6.0E-79
sp|A4YI40|SYS_METS5 Serine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=serS PE=3 SV=1 35 449 9.0E-79
sp|Q5L3Y0|SYS_GEOKA Serine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=serS PE=3 SV=1 38 456 1.0E-78
sp|Q4J8I4|SYS_SULAC Serine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=serS PE=3 SV=1 35 467 2.0E-78
sp|C0ZH54|SYS_BREBN Serine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=serS PE=3 SV=1 23 457 3.0E-78
sp|Q2YUR2|SYS_STAAB Serine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=serS PE=3 SV=1 23 451 4.0E-78
sp|B9E909|SYS_MACCJ Serine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=serS PE=3 SV=1 23 451 5.0E-78
sp|B8CZZ9|SYS_HALOH Serine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=serS PE=3 SV=1 23 449 7.0E-78
sp|B9MQM8|SYS_CALBD Serine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=serS PE=3 SV=1 35 449 1.0E-77
sp|O66647|SYS_AQUAE Serine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=serS PE=1 SV=1 23 449 2.0E-77
sp|B2J6K8|SYS_NOSP7 Serine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=serS PE=3 SV=1 23 449 2.0E-77
sp|Q3A8Q5|SYS_CARHZ Serine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=serS PE=3 SV=1 23 449 2.0E-77
sp|Q9YAG3|SYS_AERPE Serine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=serS PE=3 SV=2 36 449 3.0E-77
sp|Q65PL0|SYS_BACLD Serine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=serS PE=3 SV=1 38 456 3.0E-77
sp|B8DW52|SYS_BIFA0 Serine--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=serS PE=3 SV=1 23 451 4.0E-77
sp|A9BEX3|SYS_PETMO Serine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=serS PE=3 SV=1 23 449 5.0E-77
sp|A3CQ45|SYS_STRSV Serine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=serS PE=3 SV=1 23 457 2.0E-76
sp|Q97N17|SYS1_CLOAB Serine--tRNA ligase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=serS1 PE=3 SV=1 36 449 2.0E-76
sp|A7HN78|SYS_FERNB Serine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=serS PE=3 SV=1 36 449 2.0E-76
sp|A8AYV0|SYS_STRGC Serine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=serS PE=3 SV=1 47 457 2.0E-76
sp|Q4LAK8|SYS_STAHJ Serine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=serS PE=3 SV=1 30 459 3.0E-76
sp|A5D6D5|SYS_PELTS Serine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=serS PE=3 SV=1 23 451 3.0E-76
sp|C3NEQ7|SYS_SULIY Serine--tRNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=serS PE=3 SV=1 26 453 6.0E-76
sp|Q6A5P0|SYS_PROAC Serine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=serS PE=3 SV=1 36 451 6.0E-76
sp|A5IMJ4|SYS_THEP1 Serine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=serS PE=3 SV=1 36 448 6.0E-76
sp|B1I9K5|SYS_STRPI Serine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=serS PE=3 SV=1 23 451 6.0E-76
sp|Q8DR22|SYS_STRR6 Serine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=serS PE=3 SV=2 23 451 7.0E-76
sp|Q04M63|SYS_STRP2 Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=serS PE=3 SV=1 23 451 7.0E-76
sp|B8ZLH8|SYS_STRPJ Serine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=serS PE=3 SV=1 23 451 8.0E-76
sp|C1CPS1|SYS_STRZT Serine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=serS PE=3 SV=1 23 451 8.0E-76
sp|Q97SG0|SYS_STRPN Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=serS PE=3 SV=1 23 451 8.0E-76
sp|A3DP85|SYS_STAMF Serine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=serS PE=3 SV=1 37 449 8.0E-76
sp|C1CIR2|SYS_STRZP Serine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=serS PE=3 SV=1 23 451 9.0E-76
sp|C1C5E8|SYS_STRP7 Serine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=serS PE=3 SV=1 23 451 9.0E-76
sp|A8F3R6|SYS_PSELT Serine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=serS PE=3 SV=1 23 449 2.0E-75
sp|C1CCH7|SYS_STRZJ Serine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=serS PE=3 SV=1 23 451 2.0E-75
sp|B4U7F1|SYS_HYDS0 Serine--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=serS PE=3 SV=1 36 451 2.0E-75
sp|C3NGY7|SYS_SULIN Serine--tRNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=serS PE=3 SV=1 26 453 2.0E-75
sp|C3MQH9|SYS_SULIL Serine--tRNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=serS PE=3 SV=1 26 453 2.0E-75
sp|C4KHR4|SYS_SULIK Serine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=serS PE=3 SV=1 26 453 2.0E-75
sp|C3N6A0|SYS_SULIA Serine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=serS PE=3 SV=1 26 453 2.0E-75
sp|C3MW57|SYS_SULIM Serine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=serS PE=3 SV=1 26 453 4.0E-75
sp|C5D340|SYS_GEOSW Serine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=serS PE=3 SV=1 38 449 4.0E-75
sp|A4XJH1|SYS_CALS8 Serine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=serS PE=3 SV=1 23 449 5.0E-75
sp|B9K8V5|SYS_THENN Serine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=serS PE=3 SV=1 36 448 5.0E-75
sp|A7Z0D5|SYS_BACMF Serine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=serS PE=3 SV=1 55 449 5.0E-75
sp|Q0B0Y5|SYS_SYNWW Serine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=serS PE=3 SV=1 42 451 6.0E-75
sp|B0TAQ9|SYS_HELMI Serine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=serS PE=3 SV=1 23 449 1.0E-74
sp|A8FAD7|SYS_BACP2 Serine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=serS PE=3 SV=1 23 449 1.0E-74
sp|A1SD34|SYS_NOCSJ Serine--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=serS PE=3 SV=1 36 449 2.0E-74
sp|B0RCF1|SYS_CLAMS Serine--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=serS PE=3 SV=1 37 451 2.0E-74
sp|B8H9Q1|SYS_ARTCA Serine--tRNA ligase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=serS PE=3 SV=1 23 451 2.0E-74
sp|A0JR71|SYS_ARTS2 Serine--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=serS PE=3 SV=1 23 451 8.0E-74
sp|B5E7F2|SYS_STRP4 Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=serS PE=3 SV=1 23 451 1.0E-73
sp|P37464|SYS_BACSU Serine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=serS PE=3 SV=1 55 449 1.0E-73
sp|A1VH35|SYS_DESVV Serine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=serS PE=3 SV=1 36 451 1.0E-73
sp|Q8YQ59|SYS_NOSS1 Serine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=serS PE=3 SV=1 23 449 1.0E-73
sp|B2VA33|SYS_SULSY Serine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=serS PE=3 SV=1 36 449 1.0E-73
sp|A4IJ96|SYS_GEOTN Serine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=serS PE=3 SV=1 38 456 1.0E-73
sp|B5YGU2|SYS_THEYD Serine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=serS PE=3 SV=1 23 449 1.0E-73
sp|B0K0Z5|SYS_THEPX Serine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=serS PE=3 SV=1 23 449 1.0E-73
sp|B0KAI8|SYS_THEP3 Serine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=serS PE=3 SV=1 23 449 1.0E-73
sp|B7IFW4|SYS_THEAB Serine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=serS PE=3 SV=1 36 449 2.0E-73
sp|A5CNA2|SYS_CLAM3 Serine--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=serS PE=3 SV=1 37 451 2.0E-73
sp|B9DVD8|SYS_STRU0 Serine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=serS PE=3 SV=1 23 457 4.0E-73
sp|Q72FH6|SYS_DESVH Serine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=serS PE=3 SV=1 36 451 4.0E-73
sp|A5N469|SYS_CLOK5 Serine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=serS PE=3 SV=1 23 451 6.0E-73
sp|B9DXT9|SYS_CLOK1 Serine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=serS PE=3 SV=1 23 451 6.0E-73
sp|A6LJM6|SYS_THEM4 Serine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=serS PE=3 SV=1 23 449 6.0E-73
sp|B8D3V1|SYS_DESK1 Serine--tRNA ligase OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=serS PE=3 SV=1 36 449 7.0E-73
sp|Q3MCE0|SYS_ANAVT Serine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=serS PE=3 SV=1 23 449 1.0E-72
sp|A1R120|SYS_ARTAT Serine--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=serS PE=3 SV=1 23 451 1.0E-72
sp|A3DI04|SYS_CLOTH Serine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=serS PE=3 SV=1 23 451 2.0E-72
sp|C4KZX8|SYS_EXISA Serine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=serS PE=3 SV=1 23 451 2.0E-72
sp|B1HS47|SYS_LYSSC Serine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=serS PE=3 SV=1 39 457 2.0E-72
sp|Q81JC4|SYS_BACCR Serine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=serS PE=3 SV=1 65 451 3.0E-72
sp|B7HII5|SYS_BACC4 Serine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=serS PE=3 SV=1 65 451 3.0E-72
sp|Q6AH61|SYS_LEIXX Serine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=serS PE=3 SV=1 37 460 3.0E-72
sp|O33780|SYS_SULSO Serine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=serS PE=3 SV=2 36 453 3.0E-72
sp|P26636|SYSC_CRIGR Serine--tRNA ligase, cytoplasmic (Fragment) OS=Cricetulus griseus GN=SARS PE=2 SV=1 299 480 4.0E-72
sp|Q63HF6|SYS_BACCZ Serine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=serS PE=3 SV=1 65 451 5.0E-72
sp|A7GJT0|SYS_BACCN Serine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=serS PE=3 SV=1 23 451 5.0E-72
sp|Q73FJ3|SYS_BACC1 Serine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=serS PE=3 SV=1 65 451 6.0E-72
sp|B1I161|SYS_DESAP Serine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=serS PE=3 SV=1 23 451 6.0E-72
sp|B7IS31|SYS_BACC2 Serine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=serS PE=3 SV=1 65 451 7.0E-72
sp|Q8RH11|SYS_FUSNN Serine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=serS PE=3 SV=2 38 452 9.0E-72
sp|Q6HPZ8|SYS_BACHK Serine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|C1ES19|SYS_BACC3 Serine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|B7JJC8|SYS_BACC0 Serine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|Q81W25|SYS_BACAN Serine--tRNA ligase OS=Bacillus anthracis GN=serS PE=3 SV=1 65 451 1.0E-71
sp|A0R891|SYS_BACAH Serine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|C3LIY9|SYS_BACAC Serine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|C3P9G2|SYS_BACAA Serine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|B9IYI0|SYS_BACCQ Serine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|B7HPS8|SYS_BACC7 Serine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=serS PE=3 SV=1 65 451 1.0E-71
sp|Q9KGN4|SYS_BACHD Serine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=serS PE=3 SV=1 23 455 1.0E-71
sp|Q9X199|SYS_THEMA Serine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=serS PE=3 SV=1 36 448 2.0E-71
sp|Q03MA3|SYS_STRTD Serine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=serS PE=3 SV=1 23 457 2.0E-71
sp|A4J0G4|SYS_DESRM Serine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=serS PE=3 SV=1 23 451 2.0E-71
sp|Q8G3W7|SYS_BIFLO Serine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=serS PE=3 SV=1 23 451 3.0E-71
sp|A0Q3T2|SYS_CLONN Serine--tRNA ligase OS=Clostridium novyi (strain NT) GN=serS PE=3 SV=1 23 449 3.0E-71
sp|B3DQG7|SYS_BIFLD Serine--tRNA ligase OS=Bifidobacterium longum (strain DJO10A) GN=serS PE=3 SV=1 23 451 3.0E-71
sp|Q88XZ7|SYS2_LACPL Serine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=serS2 PE=3 SV=1 23 451 5.0E-71
sp|B1LBU6|SYS_THESQ Serine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=serS PE=3 SV=1 36 448 7.0E-71
sp|Q8DSB7|SYS_STRMU Serine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=serS PE=3 SV=1 23 459 7.0E-71
sp|B7JY63|SYS_CYAP8 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=serS PE=3 SV=1 23 449 1.0E-70
sp|A8YWU9|SYS_LACH4 Serine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=serS PE=3 SV=1 47 451 1.0E-70
sp|B0SRZ1|SYS_LEPBP Serine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=serS PE=3 SV=1 23 449 1.0E-70
sp|B0S8Z4|SYS_LEPBA Serine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=serS PE=3 SV=1 23 449 1.0E-70
sp|Q47TZ5|SYS_THEFY Serine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=serS PE=3 SV=1 36 449 1.0E-70
sp|A1TTM6|SYS_ACIAC Serine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=serS PE=3 SV=1 23 451 2.0E-70
sp|B7GN83|SYS_BIFLS Serine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=serS PE=3 SV=1 23 451 2.0E-70
sp|Q83FJ7|SYS_TROWT Serine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=serS PE=3 SV=1 37 449 2.0E-70
sp|A5HXR1|SYS_CLOBH Serine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=serS PE=3 SV=1 23 451 2.0E-70
sp|A7FQ53|SYS_CLOB1 Serine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=serS PE=3 SV=1 23 451 2.0E-70
sp|A0L6J8|SYS_MAGMM Serine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=serS PE=3 SV=1 23 451 2.0E-70
sp|Q5WM19|SYS_BACSK Serine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=serS PE=3 SV=1 23 449 3.0E-70
sp|Q6AMD2|SYS_DESPS Serine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=serS PE=3 SV=1 29 449 3.0E-70
sp|Q041F5|SYS_LACGA Serine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=serS PE=3 SV=1 47 451 3.0E-70
sp|Q8EU77|SYS_OCEIH Serine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=serS PE=3 SV=1 38 451 4.0E-70
sp|Q316Z9|SYS_DESAG Serine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=serS PE=3 SV=1 23 457 5.0E-70
sp|A0AM81|SYS_LISW6 Serine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=serS PE=3 SV=1 76 464 5.0E-70
sp|Q5FIN5|SYS_LACAC Serine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=serS PE=3 SV=1 47 451 5.0E-70
sp|Q83HA1|SYS_TROW8 Serine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=serS PE=3 SV=1 37 449 5.0E-70
sp|Q82YY9|SYS2_ENTFA Serine--tRNA ligase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=serS2 PE=3 SV=1 38 449 6.0E-70
sp|B2GF13|SYS_LACF3 Serine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=serS PE=3 SV=1 23 459 8.0E-70
sp|A1A0B7|SYS_BIFAA Serine--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=serS PE=3 SV=1 23 451 8.0E-70
sp|B5Y8D8|SYS_COPPD Serine--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=serS PE=3 SV=1 40 449 9.0E-70
sp|B2THC5|SYS_CLOBB Serine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=serS PE=3 SV=1 23 456 1.0E-69
sp|Q8ZTP4|SYS_PYRAE Serine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=serS PE=3 SV=1 37 471 1.0E-69
sp|Q8RDJ5|SYS_CALS4 Serine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=serS PE=3 SV=1 62 449 1.0E-69
sp|B1L1M0|SYS_CLOBM Serine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=serS PE=3 SV=1 23 451 1.0E-69
sp|B1IDV4|SYS_CLOBK Serine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=serS PE=3 SV=1 23 451 1.0E-69
sp|B2UX54|SYS_CLOBA Serine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=serS PE=3 SV=1 23 456 2.0E-69
sp|A7ZBR7|SYS_CAMC1 Serine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=serS PE=3 SV=1 47 449 2.0E-69
sp|Q8GMR7|SYS_SYNE7 Serine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=serS PE=3 SV=4 23 452 2.0E-69
sp|B2G575|SYS_LACRJ Serine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=serS PE=3 SV=1 23 464 2.0E-69
sp|A5VHP5|SYS_LACRD Serine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=serS PE=3 SV=1 23 464 2.0E-69
sp|A7G9C5|SYS_CLOBL Serine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=serS PE=3 SV=1 23 451 2.0E-69
sp|B3W8V7|SYS_LACCB Serine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=serS PE=3 SV=1 23 451 3.0E-69
sp|Q74HZ5|SYS_LACJO Serine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=serS PE=3 SV=1 47 451 4.0E-69
sp|Q037M7|SYS_LACC3 Serine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=serS PE=3 SV=1 23 451 4.0E-69
sp|B8DQP8|SYS_DESVM Serine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=serS PE=3 SV=1 37 451 6.0E-69
sp|A5EXS3|SYS_DICNV Serine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=serS PE=3 SV=1 61 457 6.0E-69
sp|B4S6M3|SYS_PROA2 Serine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=serS PE=3 SV=1 23 448 7.0E-69
sp|Q1JKF1|SYS_STRPC Serine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=serS PE=3 SV=1 23 451 9.0E-69
sp|Q1JA99|SYS_STRPB Serine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=serS PE=3 SV=1 23 451 9.0E-69
sp|Q03ZQ9|SYS_LEUMM Serine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=serS PE=3 SV=1 39 457 1.0E-68
sp|Q839Q8|SYS1_ENTFA Serine--tRNA ligase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=serS1 PE=3 SV=1 38 451 1.0E-68
sp|Q48RS8|SYS_STRPM Serine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=serS PE=3 SV=1 23 451 1.0E-68
sp|Q1J594|SYS_STRPF Serine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=serS PE=3 SV=1 23 451 1.0E-68
sp|Q8NZN7|SYS_STRP8 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=serS PE=3 SV=1 23 451 1.0E-68
sp|Q5XAF1|SYS_STRP6 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=serS PE=3 SV=1 23 451 1.0E-68
sp|Q99YE2|SYS_STRP1 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=serS PE=3 SV=1 23 451 1.0E-68
sp|C6BS43|SYS_DESAD Serine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=serS PE=3 SV=1 40 451 1.0E-68
sp|P67566|SYS_STRA5 Serine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=serS PE=3 SV=1 71 456 2.0E-68
sp|P67565|SYS_STRA3 Serine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=serS PE=3 SV=1 71 456 2.0E-68
sp|Q3K326|SYS_STRA1 Serine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=serS PE=3 SV=1 71 456 2.0E-68
sp|B5XHX4|SYS_STRPZ Serine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=serS PE=3 SV=1 23 451 2.0E-68
sp|Q8Y3T4|SYS_LISMO Serine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=serS PE=3 SV=1 76 464 2.0E-68
sp|P0DG57|SYS_STRPQ Serine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=serS PE=3 SV=1 23 451 2.0E-68
sp|P0DG56|SYS_STRP3 Serine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=serS PE=3 SV=1 23 451 2.0E-68
sp|A0RQK5|SYS_CAMFF Serine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=serS PE=3 SV=1 91 449 3.0E-68
sp|A8ZXS1|SYS_DESOH Serine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=serS PE=3 SV=1 23 449 3.0E-68
sp|C5BWI5|SYS_BEUC1 Serine--tRNA ligase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=serS PE=3 SV=1 36 451 3.0E-68
sp|Q048F6|SYS_LACDB Serine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=serS PE=3 SV=1 41 457 3.0E-68
sp|Q1G8N2|SYS_LACDA Serine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=serS PE=3 SV=1 41 457 3.0E-68
sp|B8DD73|SYS_LISMH Serine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=serS PE=3 SV=1 76 464 3.0E-68
sp|Q71W17|SYS_LISMF Serine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=serS PE=3 SV=1 76 464 3.0E-68
sp|C1L082|SYS_LISMC Serine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=serS PE=3 SV=1 76 464 3.0E-68
sp|C1FPI7|SYS_CLOBJ Serine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=serS PE=3 SV=1 23 451 3.0E-68
sp|Q1JFE4|SYS_STRPD Serine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=serS PE=3 SV=1 23 451 4.0E-68
sp|C0M858|SYS_STRE4 Serine--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=serS PE=3 SV=1 23 451 4.0E-68
sp|B9L7B0|SYS_NAUPA Serine--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=serS PE=3 SV=1 54 449 4.0E-68
sp|A7GWY9|SYS_CAMC5 Serine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=serS PE=3 SV=1 45 449 4.0E-68
sp|A6TJ99|SYS_ALKMQ Serine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=serS PE=3 SV=1 23 451 4.0E-68
sp|C3KXS1|SYS_CLOB6 Serine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=serS PE=3 SV=1 23 451 5.0E-68
sp|C0ME07|SYS_STRS7 Serine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=serS PE=3 SV=1 45 451 5.0E-68
sp|Q8XPE9|SYS_CLOPE Serine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=serS PE=3 SV=2 43 449 5.0E-68
sp|C5C878|SYS_MICLC Serine--tRNA ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=serS PE=3 SV=1 23 455 6.0E-68
sp|Q0TV53|SYS_CLOP1 Serine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=serS PE=3 SV=1 43 449 7.0E-68
sp|Q0SWW9|SYS_CLOPS Serine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=serS PE=3 SV=1 43 449 8.0E-68
sp|B0UUT7|SYS_HISS2 Serine--tRNA ligase OS=Histophilus somni (strain 2336) GN=serS PE=3 SV=1 39 451 9.0E-68
sp|B4U1C3|SYS_STREM Serine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=serS PE=3 SV=1 23 451 9.0E-68
sp|B3EAQ9|SYS_GEOLS Serine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=serS PE=3 SV=1 79 451 1.0E-67
sp|Q6F2A0|SYS_MESFL Serine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=serS PE=3 SV=1 23 449 1.0E-67
sp|Q0I471|SYS_HAES1 Serine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=serS PE=3 SV=1 61 451 1.0E-67
sp|B8E0R9|SYS_DICTD Serine--tRNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=serS PE=3 SV=1 36 449 1.0E-67
sp|Q1WVB3|SYS_LACS1 Serine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=serS PE=3 SV=1 42 451 2.0E-67
sp|A2BXQ6|SYS_PROM5 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=serS PE=3 SV=1 70 449 2.0E-67
sp|Q02XG6|SYS_LACLS Serine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=serS PE=3 SV=1 79 451 2.0E-67
sp|A2RJ76|SYS_LACLM Serine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=serS PE=3 SV=1 79 451 2.0E-67
sp|B2GGG9|SYS_KOCRD Serine--tRNA ligase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=serS PE=3 SV=1 30 459 2.0E-67
sp|Q2RMH8|SYS_MOOTA Serine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=serS PE=3 SV=1 36 457 2.0E-67
sp|A1K581|SYS_AZOSB Serine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=serS PE=3 SV=1 61 459 3.0E-67
sp|B2A2Z8|SYS_NATTJ Serine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=serS PE=3 SV=1 54 451 3.0E-67
sp|A1VYA9|SYS_CAMJJ Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=serS PE=3 SV=1 95 449 3.0E-67
sp|A2RCY1|SYS_STRPG Serine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=serS PE=3 SV=1 23 451 3.0E-67
sp|Q2SY90|SYS_BURTA Serine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=serS PE=3 SV=1 59 451 4.0E-67
sp|C1B914|SYS_RHOOB Serine--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=serS PE=3 SV=1 23 449 4.0E-67
sp|A3NCC8|SYS_BURP6 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=serS PE=3 SV=1 59 452 5.0E-67
sp|Q926Z9|SYS_LISIN Serine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=serS PE=3 SV=1 76 464 5.0E-67
sp|Q4K9V7|SYS_PSEF5 Serine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=serS PE=3 SV=1 58 451 6.0E-67
sp|C3JY54|SYS_PSEFS Serine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=serS PE=3 SV=1 58 452 6.0E-67
sp|Q63RS1|SYS_BURPS Serine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|Q3JPQ8|SYS_BURP1 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|A3NY56|SYS_BURP0 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|A1V1N6|SYS_BURMS Serine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|Q62HY1|SYS_BURMA Serine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|A2S9G4|SYS_BURM9 Serine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|A3MMN2|SYS_BURM7 Serine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=serS PE=3 SV=1 59 452 6.0E-67
sp|Q2JKN4|SYS_SYNJB Serine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=serS PE=3 SV=1 23 449 6.0E-67
sp|A8G5Y6|SYS_PROM2 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=serS PE=3 SV=1 74 449 6.0E-67
sp|C4LGQ1|SYS_CORK4 Serine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=serS PE=3 SV=1 30 449 7.0E-67
sp|C6E7Z3|SYS_GEOSM Serine--tRNA ligase OS=Geobacter sp. (strain M21) GN=serS PE=3 SV=1 58 452 7.0E-67
sp|Q21TF1|SYS_RHOFT Serine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=serS PE=3 SV=1 23 451 7.0E-67
sp|Q899T6|SYS_CLOTE Serine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=serS PE=3 SV=1 23 451 7.0E-67
sp|Q38UM4|SYS_LACSS Serine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=serS PE=3 SV=1 54 451 9.0E-67
sp|A7H4Y8|SYS_CAMJD Serine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=serS PE=3 SV=1 95 449 1.0E-66
sp|Q1AX26|SYS_RUBXD Serine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=serS PE=3 SV=1 23 449 1.0E-66
sp|Q2S1G4|SYS_SALRD Serine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=serS PE=3 SV=1 23 448 1.0E-66
sp|B7KCF5|SYS_CYAP7 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=serS PE=3 SV=1 23 449 1.0E-66
sp|C5CWN5|SYS_VARPS Serine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=serS PE=3 SV=1 44 451 1.0E-66
sp|B2T1A6|SYS_BURPP Serine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=serS PE=3 SV=1 59 451 1.0E-66
sp|A9AES3|SYS_BURM1 Serine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=serS PE=3 SV=1 59 451 1.0E-66
sp|Q9AEN2|SYS_BURCE Serine--tRNA ligase OS=Burkholderia cepacia GN=serS PE=3 SV=1 59 451 1.0E-66
sp|Q9PIB3|SYS_CAMJE Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=serS PE=3 SV=1 43 449 2.0E-66
sp|Q9CEX2|SYS_LACLA Serine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=serS PE=3 SV=1 79 451 2.0E-66
sp|C1DBY7|SYS_LARHH Serine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=serS PE=3 SV=1 56 457 2.0E-66
sp|B1YUL5|SYS_BURA4 Serine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=serS PE=3 SV=1 59 451 2.0E-66
sp|Q0VQ06|SYS_ALCBS Serine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=serS PE=3 SV=1 36 451 2.0E-66
sp|Q0S9E8|SYS_RHOJR Serine--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=serS PE=3 SV=1 23 449 2.0E-66
sp|B9KFN2|SYS_CAMLR Serine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=serS PE=3 SV=1 129 449 2.0E-66
sp|C4L937|SYS_TOLAT Serine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=serS PE=3 SV=1 58 451 3.0E-66
sp|Q74H55|SYS_GEOSL Serine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=serS PE=3 SV=1 61 451 3.0E-66
sp|A0LWR6|SYS_ACIC1 Serine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=serS PE=3 SV=1 36 449 3.0E-66
sp|A0K5F5|SYS_BURCH Serine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=serS PE=3 SV=1 59 451 4.0E-66
sp|Q7V0R7|SYS_PROMP Serine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=serS PE=3 SV=1 67 449 4.0E-66
sp|B4EBR4|SYS_BURCJ Serine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=serS PE=3 SV=1 59 451 4.0E-66
sp|B1Y9Y4|SYS_PYRNV Serine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=serS PE=3 SV=1 36 449 4.0E-66
sp|B0JTT9|SYS_MICAN Serine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=serS PE=3 SV=1 23 449 6.0E-66
sp|Q39IN7|SYS_BURL3 Serine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=serS PE=3 SV=1 59 451 6.0E-66
sp|Q3KA84|SYS_PSEPF Serine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=serS PE=3 SV=1 58 451 6.0E-66
sp|Q143D9|SYS_BURXL Serine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=serS PE=3 SV=1 23 451 6.0E-66
sp|A6V4H5|SYS_PSEA7 Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=serS PE=3 SV=1 54 451 7.0E-66
sp|Q8FLY5|SYS_COREF Serine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=serS PE=3 SV=2 36 449 7.0E-66
sp|Q8NLP6|SYS_CORGL Serine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=serS PE=3 SV=1 36 449 8.0E-66
sp|A8FKH6|SYS_CAMJ8 Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=serS PE=3 SV=1 120 449 8.0E-66
sp|B5E8F6|SYS_GEOBB Serine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=serS PE=3 SV=1 58 451 8.0E-66
sp|A7HZX6|SYS_CAMHC Serine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=serS PE=3 SV=1 47 449 1.0E-65
sp|B2JEF5|SYS_BURP8 Serine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=serS PE=3 SV=1 59 452 1.0E-65
sp|Q10YR2|SYS_TRIEI Serine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=serS PE=3 SV=1 23 449 1.0E-65
sp|Q1H290|SYS_METFK Serine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=serS PE=3 SV=1 54 451 1.0E-65
sp|A4JCA3|SYS_BURVG Serine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=serS PE=3 SV=1 59 451 1.0E-65
sp|B7J1F4|SYS_BORBZ Serine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=serS PE=3 SV=1 23 458 1.0E-65
sp|O51244|SYS_BORBU Serine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=serS PE=3 SV=1 23 458 1.0E-65
sp|B9MEG7|SYS_ACIET Serine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=serS PE=3 SV=1 23 451 1.0E-65
sp|B1JX98|SYS_BURCC Serine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=serS PE=3 SV=1 59 451 1.0E-65
sp|A9M1Q6|SYS_NEIM0 Serine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=serS PE=3 SV=1 59 451 2.0E-65
sp|Q0BHH5|SYS_BURCM Serine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=serS PE=3 SV=1 59 451 2.0E-65
sp|Q0SNT6|SYS_BORAP Serine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=serS PE=3 SV=1 23 458 2.0E-65
sp|Q662D8|SYS_BORBP Serine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=serS PE=3 SV=1 23 458 2.0E-65
sp|Q083B6|SYS_SHEFN Serine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=serS PE=3 SV=1 54 451 2.0E-65
sp|A3PE37|SYS_PROM0 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=serS PE=3 SV=1 104 449 2.0E-65
sp|Q67TJ8|SYS_SYMTH Serine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=serS PE=3 SV=1 23 448 3.0E-65
sp|B4SF71|SYS_PELPB Serine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=serS PE=3 SV=1 79 448 3.0E-65
sp|Q9I0M6|SYS_PSEAE Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=serS PE=3 SV=1 54 451 4.0E-65
sp|Q02NA4|SYS_PSEAB Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=serS PE=3 SV=1 54 451 4.0E-65
sp|B7UW10|SYS_PSEA8 Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=serS PE=3 SV=1 54 451 4.0E-65
sp|A1KV93|SYS_NEIMF Serine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=serS PE=3 SV=1 59 451 4.0E-65
sp|B6IZT4|SYS_COXB2 Serine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=serS PE=3 SV=1 38 455 4.0E-65
sp|Q8DIN0|SYS_THEEB Serine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=serS PE=3 SV=1 30 449 4.0E-65
sp|Q5HW78|SYS_CAMJR Serine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=serS PE=3 SV=1 43 449 4.0E-65
sp|A1WBD4|SYS_ACISJ Serine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=serS PE=3 SV=1 23 451 4.0E-65
sp|Q2KWF5|SYS_BORA1 Serine--tRNA ligase OS=Bordetella avium (strain 197N) GN=serS PE=3 SV=1 61 451 5.0E-65
sp|B2UPP6|SYS_AKKM8 Serine--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=serS PE=3 SV=1 23 449 5.0E-65
sp|C1DKY8|SYS_AZOVD Serine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=serS PE=3 SV=1 73 451 5.0E-65
sp|B3ENZ9|SYS_CHLPB Serine--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=serS PE=3 SV=1 23 448 6.0E-65
sp|A2BSA4|SYS_PROMS Serine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=serS PE=3 SV=1 52 449 7.0E-65
sp|A9KFP4|SYS_COXBN Serine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=serS PE=3 SV=1 38 455 7.0E-65
sp|A8MEB3|SYS_ALKOO Serine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=serS PE=3 SV=1 23 451 7.0E-65
sp|Q6MRK1|SYS_BDEBA Serine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=serS PE=3 SV=1 47 451 9.0E-65
sp|Q8PYJ6|SYS_METMA Serine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=serS PE=3 SV=1 36 451 9.0E-65
sp|Q3AV47|SYS_SYNS9 Serine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=serS PE=3 SV=1 36 449 1.0E-64
sp|Q46F20|SYS_METBF Serine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=serS1 PE=1 SV=2 23 451 1.0E-64
sp|P39919|SYS_COXBU Serine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=serS PE=3 SV=1 38 455 1.0E-64
sp|A9NDR1|SYS_COXBR Serine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=serS PE=3 SV=1 38 455 1.0E-64
sp|B5YEY8|SYS_DICT6 Serine--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=serS PE=3 SV=1 36 449 1.0E-64
sp|Q6NEN2|SYS_CORDI Serine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=serS PE=3 SV=1 36 449 1.0E-64
sp|A3MX52|SYS_PYRCJ Serine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=serS PE=3 SV=1 37 449 1.0E-64
sp|A4G3W7|SYS_HERAR Serine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=serS PE=3 SV=1 54 457 1.0E-64
sp|Q7UXX6|SYS_RHOBA Serine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=serS PE=3 SV=2 40 449 2.0E-64
sp|B6J7K7|SYS_COXB1 Serine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=serS PE=3 SV=1 38 455 2.0E-64
sp|Q9JY95|SYS_NEIMB Serine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=serS PE=3 SV=1 61 451 2.0E-64
sp|B8HL86|SYS_CYAP4 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=serS PE=3 SV=1 57 449 2.0E-64
sp|B8FNA6|SYS_DESAA Serine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=serS PE=3 SV=1 57 451 2.0E-64
sp|B3PL38|SYS_CELJU Serine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=serS PE=3 SV=1 54 460 3.0E-64
sp|Q03EA5|SYS_PEDPA Serine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=serS PE=3 SV=1 38 452 3.0E-64
sp|B8J4S2|SYS_DESDA Serine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=serS PE=3 SV=1 37 457 3.0E-64
sp|Q1B1V1|SYS_MYCSS Serine--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=serS PE=3 SV=1 23 449 3.0E-64
sp|A1UN98|SYS_MYCSK Serine--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=serS PE=3 SV=1 23 449 3.0E-64
sp|A6SX50|SYS_JANMA Serine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=serS PE=3 SV=1 59 457 3.0E-64
sp|Q5Z3K9|SYS_NOCFA Serine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=serS PE=3 SV=1 36 449 3.0E-64
sp|A5UYX1|SYS_ROSS1 Serine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=serS PE=3 SV=1 23 451 3.0E-64
sp|Q31HK9|SYS_THICR Serine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=serS PE=3 SV=1 54 452 4.0E-64
sp|A1ALM7|SYS_PELPD Serine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=serS PE=3 SV=1 79 451 4.0E-64
sp|Q39PU1|SYS_GEOMG Serine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=serS PE=3 SV=1 36 451 4.0E-64
sp|Q65SK3|SYS_MANSM Serine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=serS PE=3 SV=1 58 451 4.0E-64
sp|Q5F752|SYS_NEIG1 Serine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=serS PE=3 SV=1 59 451 5.0E-64
sp|A4VLU7|SYS_PSEU5 Serine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=serS PE=3 SV=1 58 451 5.0E-64
sp|Q3A7Q8|SYS_PELCD Serine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=serS PE=3 SV=1 65 452 6.0E-64
sp|A4W8R7|SYS_ENT38 Serine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=serS PE=3 SV=1 36 451 9.0E-64
sp|A0KJE8|SYS_AERHH Serine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=serS PE=3 SV=1 54 451 9.0E-64
sp|A0LI63|SYS_SYNFM Serine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=serS PE=3 SV=1 23 449 1.0E-63
sp|B0RZY8|SYS_FINM2 Serine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=serS PE=3 SV=1 23 448 1.0E-63
sp|A4SNK6|SYS_AERS4 Serine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=serS PE=3 SV=1 54 451 1.0E-63
sp|A1WP10|SYS_VEREI Serine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=serS PE=3 SV=1 61 457 1.0E-63
sp|A3Q7P6|SYS_MYCSJ Serine--tRNA ligase OS=Mycobacterium sp. (strain JLS) GN=serS PE=3 SV=1 23 449 1.0E-63
sp|A5W1H6|SYS_PSEP1 Serine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=serS PE=3 SV=1 54 452 1.0E-63
sp|B4RN50|SYS_NEIG2 Serine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=serS PE=3 SV=1 59 451 1.0E-63
sp|Q0KDK9|SYS_CUPNH Serine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=serS PE=3 SV=1 59 457 2.0E-63
sp|B5ZAT6|SYS_UREU1 Serine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=serS PE=3 SV=1 41 449 2.0E-63
sp|Q3AM35|SYS_SYNSC Serine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=serS PE=3 SV=1 36 449 2.0E-63
sp|Q7NY99|SYS_CHRVO Serine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=serS PE=3 SV=1 61 449 2.0E-63
sp|Q8TIU3|SYS_METAC Serine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=serS PE=3 SV=1 36 452 2.0E-63
sp|B7I6V5|SYS_ACIB5 Serine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=serS PE=3 SV=1 36 451 2.0E-63
sp|B7GXI2|SYS_ACIB3 Serine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=serS PE=3 SV=1 36 451 2.0E-63
sp|A1RRX4|SYS_PYRIL Serine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=serS PE=3 SV=1 36 449 2.0E-63
sp|Q7NMP9|SYS_GLOVI Serine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=serS PE=3 SV=1 36 449 2.0E-63
sp|A1VSK4|SYS_POLNA Serine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=serS PE=3 SV=1 23 451 2.0E-63
sp|Q6F8G5|SYS_ACIAD Serine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=serS PE=3 SV=2 59 451 2.0E-63
sp|A1S6H5|SYS_SHEAM Serine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=serS PE=3 SV=1 54 451 3.0E-63
sp|A6VNC3|SYS_ACTSZ Serine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=serS PE=3 SV=1 61 449 3.0E-63
sp|A6T6Z0|SYS_KLEP7 Serine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=serS PE=3 SV=1 36 451 3.0E-63
sp|Q255Z9|SYS_CHLFF Serine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=serS PE=3 SV=1 37 449 3.0E-63
sp|A0R638|SYS_MYCS2 Serine--tRNA ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=serS PE=1 SV=1 36 449 3.0E-63
sp|B9L131|SYS_THERP Serine--tRNA ligase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=serS PE=3 SV=1 23 451 3.0E-63
sp|Q47GH9|SYS_DECAR Serine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=serS PE=3 SV=1 61 451 3.0E-63
sp|Q88FT2|SYS_PSEPK Serine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=serS PE=3 SV=1 54 452 3.0E-63
sp|Q6MUG5|SYS_MYCMS Serine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=serS PE=3 SV=1 76 449 4.0E-63
sp|A6Q4S8|SYS_NITSB Serine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=serS PE=3 SV=1 53 449 5.0E-63
sp|A1TGX4|SYS_MYCVP Serine--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=serS PE=3 SV=1 130 457 5.0E-63
sp|B9LIV1|SYS_CHLSY Serine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=serS PE=3 SV=1 23 457 5.0E-63
sp|A9WE34|SYS_CHLAA Serine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=serS PE=3 SV=1 23 457 5.0E-63
sp|B3R376|SYS_CUPTR Serine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=serS PE=3 SV=1 59 457 5.0E-63
sp|B5XY99|SYS_KLEP3 Serine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=serS PE=3 SV=1 36 451 6.0E-63
sp|B2HXU5|SYS_ACIBC Serine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=serS PE=3 SV=1 36 451 6.0E-63
sp|B2HMM1|SYS_MYCMM Serine--tRNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=serS PE=3 SV=1 36 449 6.0E-63
sp|A8FV67|SYS_SHESH Serine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=serS PE=3 SV=1 36 451 7.0E-63
sp|B1JRF0|SYS_YERPY Serine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|Q66CJ9|SYS_YERPS Serine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|A4TN29|SYS_YERPP Serine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|Q1CGF1|SYS_YERPN Serine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|A9R5V2|SYS_YERPG Serine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|Q8ZGC4|SYS_YERPE Serine--tRNA ligase OS=Yersinia pestis GN=serS PE=3 SV=1 38 451 7.0E-63
sp|B2KA12|SYS_YERPB Serine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|Q1CA85|SYS_YERPA Serine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|A7FJY0|SYS_YERP3 Serine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=serS PE=3 SV=1 38 451 7.0E-63
sp|B8G8S1|SYS_CHLAD Serine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=serS PE=3 SV=1 23 452 7.0E-63
sp|A4XUX4|SYS_PSEMY Serine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=serS PE=3 SV=1 61 451 7.0E-63
sp|A0PX13|SYS_MYCUA Serine--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=serS PE=3 SV=1 36 449 7.0E-63
sp|Q9JT77|SYS_NEIMA Serine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=serS PE=3 SV=1 59 451 8.0E-63
sp|Q1IBD0|SYS_PSEE4 Serine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=serS PE=3 SV=1 54 452 8.0E-63
sp|Q3SJH9|SYS_THIDA Serine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=serS PE=3 SV=1 61 457 9.0E-63
sp|Q9PR38|SYS_UREPA Serine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=serS PE=3 SV=1 36 449 1.0E-62
sp|B1AI95|SYS_UREP2 Serine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=serS PE=3 SV=1 36 449 1.0E-62
sp|B1JBE0|SYS_PSEPW Serine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=serS PE=3 SV=1 54 452 1.0E-62
sp|Q48H74|SYS_PSE14 Serine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=serS PE=3 SV=1 58 451 1.0E-62
sp|B2KEV5|SYS_ELUMP Serine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=serS PE=3 SV=1 23 449 1.0E-62
sp|C0QLD3|SYS_DESAH Serine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=serS PE=3 SV=1 79 451 1.0E-62
sp|B3R0F5|SYS_PHYMT Serine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=serS PE=3 SV=1 38 449 2.0E-62
sp|B5EMC5|SYS_ACIF5 Serine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=serS PE=3 SV=1 37 451 2.0E-62
sp|B7J4C9|SYS_ACIF2 Serine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=serS PE=3 SV=1 37 451 2.0E-62
sp|Q5WZ31|SYS_LEGPL Serine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=serS PE=3 SV=1 61 451 2.0E-62
sp|A6QBP2|SYS_SULNB Serine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=serS PE=3 SV=1 45 449 2.0E-62
sp|B0KLW8|SYS_PSEPG Serine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=serS PE=3 SV=1 35 452 2.0E-62
sp|A7NJB8|SYS_ROSCS Serine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=serS PE=3 SV=1 23 452 2.0E-62
sp|Q8RWT8|SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA7 PE=2 SV=1 38 451 2.0E-62
sp|B3QV79|SYS_CHLT3 Serine--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=serS PE=3 SV=1 23 449 3.0E-62
sp|B9M3Q9|SYS_GEODF Serine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=serS PE=3 SV=1 79 452 3.0E-62
sp|B3EF00|SYS_CHLL2 Serine--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=serS PE=3 SV=1 23 448 3.0E-62
sp|A5IH84|SYS_LEGPC Serine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=serS PE=3 SV=1 61 451 3.0E-62
sp|Q5X7N0|SYS_LEGPA Serine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=serS PE=3 SV=1 61 451 4.0E-62
sp|A9BYK5|SYS_DELAS Serine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=serS PE=3 SV=1 23 451 5.0E-62
sp|B1XJM0|SYS_SYNP2 Serine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=serS PE=3 SV=1 23 449 5.0E-62
sp|Q820S5|SYS_NITEU Serine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=serS PE=3 SV=1 61 451 6.0E-62
sp|Q21K22|SYS_SACD2 Serine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=serS PE=3 SV=1 52 451 6.0E-62
sp|A6W0C9|SYS_MARMS Serine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=serS PE=3 SV=1 23 451 6.0E-62
sp|B1MEI9|SYS_MYCA9 Serine--tRNA ligase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=serS PE=3 SV=1 23 449 7.0E-62
sp|Q73IW5|SYS_WOLPM Serine--tRNA ligase OS=Wolbachia pipientis wMel GN=serS PE=3 SV=1 27 449 7.0E-62
sp|B2U9Y5|SYS_RALPJ Serine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=serS PE=3 SV=1 59 451 7.0E-62
sp|Q4ZRL5|SYS_PSEU2 Serine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=serS PE=3 SV=1 58 451 9.0E-62
sp|B0BYR8|SYS_ACAM1 Serine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=serS PE=3 SV=1 30 449 9.0E-62
sp|Q1LQJ5|SYS_CUPMC Serine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=serS PE=3 SV=1 58 457 9.0E-62
sp|Q5ZY59|SYS_LEGPH Serine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=serS PE=3 SV=1 61 451 1.0E-61
sp|Q87ZS9|SYS_PSESM Serine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=serS PE=3 SV=1 58 451 1.0E-61
sp|Q7VM65|SYS_HAEDU Serine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=serS PE=3 SV=1 54 451 1.0E-61
sp|B4EV93|SYS_PROMH Serine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=serS PE=3 SV=1 36 451 1.0E-61
sp|Q1DAZ4|SYS_MYXXD Serine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=serS PE=3 SV=1 60 458 1.0E-61
sp|P73201|SYS_SYNY3 Serine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=serS PE=3 SV=1 41 449 1.0E-61
sp|Q8XWY3|SYS_RALSO Serine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=serS PE=3 SV=1 59 457 2.0E-61
sp|Q88Z60|SYS1_LACPL Serine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=serS1 PE=3 SV=1 36 451 2.0E-61
sp|Q2SJB8|SYS_HAHCH Serine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=serS PE=3 SV=1 66 452 2.0E-61
sp|A2C798|SYS_PROM3 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=serS PE=3 SV=1 36 438 2.0E-61
sp|Q2W4A0|SYS_MAGSA Serine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=serS PE=3 SV=1 36 451 2.0E-61
sp|B8F4Q5|SYS_HAEPS Serine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=serS PE=3 SV=1 46 452 2.0E-61
sp|Q7V608|SYS_PROMM Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=serS PE=3 SV=2 36 438 2.0E-61
sp|A8AII9|SYS_CITK8 Serine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=serS PE=3 SV=1 36 451 2.0E-61
sp|Q2YCN3|SYS_NITMU Serine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=serS PE=3 SV=1 56 457 2.0E-61
sp|Q4FR92|SYS_PSYA2 Serine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=serS PE=3 SV=1 61 456 3.0E-61
sp|C4XHA0|SYS_DESMR Serine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=serS PE=3 SV=1 23 451 3.0E-61
sp|P57836|SYS_PASMU Serine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=serS PE=3 SV=1 46 451 3.0E-61
sp|Q3ZWY0|SYS_DEHMC Serine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=serS PE=3 SV=1 23 449 3.0E-61
sp|A5FRN4|SYS_DEHMB Serine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=serS PE=3 SV=1 23 449 3.0E-61
sp|B0TUP4|SYS_SHEHH Serine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=serS PE=3 SV=1 56 451 4.0E-61
sp|B7LN61|SYS_ESCF3 Serine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=serS PE=3 SV=1 36 451 4.0E-61
sp|Q8YGS6|SYS_BRUME Serine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=serS PE=3 SV=2 23 451 5.0E-61
sp|C0RIL8|SYS_BRUMB Serine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=serS PE=3 SV=1 23 451 5.0E-61
sp|B2TUI5|SYS_SHIB3 Serine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=serS PE=3 SV=1 36 451 5.0E-61
sp|Q03PU5|SYS_LACBA Serine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=serS PE=3 SV=1 36 451 5.0E-61
sp|Q57DM2|SYS_BRUAB Serine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=serS PE=3 SV=1 23 451 5.0E-61
sp|Q2YNM6|SYS_BRUA2 Serine--tRNA ligase OS=Brucella abortus (strain 2308) GN=serS PE=3 SV=1 23 451 5.0E-61
sp|B2S5B8|SYS_BRUA1 Serine--tRNA ligase OS=Brucella abortus (strain S19) GN=serS PE=3 SV=1 23 451 5.0E-61
sp|B4TD24|SYS_SALHS Serine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|Q9CDC1|SYS_MYCLE Serine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=serS PE=3 SV=1 36 458 6.0E-61
sp|B8ZTU5|SYS_MYCLB Serine--tRNA ligase OS=Mycobacterium leprae (strain Br4923) GN=serS PE=3 SV=1 36 458 6.0E-61
sp|Q3Z3M7|SYS_SHISS Serine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|P0A8L4|SYS_SHIFL Serine--tRNA ligase OS=Shigella flexneri GN=serS PE=3 SV=1 36 451 6.0E-61
sp|Q0T8M9|SYS_SHIF8 Serine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|Q323L0|SYS_SHIBS Serine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|Q1RE21|SYS_ECOUT Serine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|B1LJX0|SYS_ECOSM Serine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|B6I8W4|SYS_ECOSE Serine--tRNA ligase OS=Escherichia coli (strain SE11) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|B7NAP4|SYS_ECOLU Serine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|P0A8L1|SYS_ECOLI Serine--tRNA ligase OS=Escherichia coli (strain K12) GN=serS PE=1 SV=1 36 451 6.0E-61
sp|B1IWN0|SYS_ECOLC Serine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|P0A8L2|SYS_ECOL6 Serine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|Q0TJF7|SYS_ECOL5 Serine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=serS PE=3 SV=1 36 451 6.0E-61
sp|A1A9D6|SYS_ECOK1 Serine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=serS PE=3 SV=1 36 451 6.0E-61
sp|A7ZYJ7|SYS_ECOHS Serine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=serS PE=3 SV=1 36 451 6.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7586 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3729
Ophiocordyceps camponoti-floridani Ophcf2|00078
Ophiocordyceps camponoti-rufipedis Ophun1|641
Ophiocordyceps kimflemingae Ophio5|944
Ophiocordyceps subramaniannii Hirsu2|5221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7586
MLGVRRDSKPFISGYYRGPSSSMLDVVDFIKERGGDPEKIRESQRRRNASVEVVDEVIALFEDHRKTNYSASQTN
SKINDIQKQIGAKKKAKENADDLLKQKVELEKEKKSLVESAAEKEVQLKSKIKTIGNYVHDSVPVSNNEDNNEVL
RTWAPEGVTVEKRNVLSHHEVLLRLDGYDPDRGVKVVGHRGYFLRQWGVFLNQALINYGLEFLSQRGYTALQAPQ
FMLKEYMAKTAQLEDFDEELYKVVDGEAKNDKYLIATSEQPISAFHADEWLIAKDLPIKYAGFSSCYRREAGSHG
RDAWGIYRVHQFEKVEQFILTEPEKSWEALDEMMSTSEEFYQSLRLPYQVIAIVSGALNNAASKKLDLEAWFPFQ
GEYKELVSCSNCTDYQSRALEIRYGSKTVTDTKKKYVHCLNATLCATTRTLCCILENYQTEEGFRVPDPLRKYLP
GTPDFIPFSKELPKDSTSQKALPNRPKGGK*
Coding >OphauG2|7586
ATGCTCGGTGTTAGACGTGATAGCAAGCCGTTCATATCTGGATATTATCGAGGACCGAGCAGCAGTATGCTCGAC
GTGGTAGATTTCATCAAGGAGCGTGGTGGCGACCCGGAAAAAATTCGCGAATCACAACGGCGCCGTAACGCCAGC
GTCGAAGTTGTTGACGAGGTCATAGCTCTCTTTGAGGACCATCGCAAGACCAATTACAGCGCTAGCCAGACCAAC
AGTAAAATCAACGACATCCAAAAGCAAATTGGAGCAAAAAAGAAGGCCAAAGAAAATGCCGACGACCTGTTGAAA
CAGAAAGTCGAACTGGAAAAGGAAAAGAAAAGCCTAGTAGAATCGGCCGCAGAAAAGGAAGTCCAGCTCAAGTCC
AAGATTAAGACGATTGGCAACTATGTCCACGACTCGGTTCCTGTCAGCAACAACGAGGATAACAACGAGGTGCTT
CGTACGTGGGCCCCTGAGGGTGTCACGGTCGAGAAGCGCAACGTACTATCACACCACGAGGTTCTCCTACGCCTC
GACGGCTATGACCCTGACCGTGGCGTCAAGGTTGTTGGACATCGCGGTTACTTCTTGCGCCAATGGGGTGTCTTT
TTGAACCAGGCTCTCATCAACTATGGCCTCGAGTTCCTCTCTCAACGTGGATACACTGCCCTGCAGGCACCTCAA
TTCATGCTCAAGGAGTATATGGCCAAGACGGCGCAACTCGAGGATTTCGATGAGGAGCTCTACAAGGTGGTGGAC
GGCGAGGCAAAGAATGACAAGTACCTAATAGCAACGTCGGAGCAGCCCATTTCAGCCTTTCATGCCGATGAATGG
CTTATTGCCAAGGACTTGCCAATCAAGTATGCTGGTTTCAGCTCATGCTATAGACGTGAGGCTGGCTCCCACGGC
CGCGATGCCTGGGGCATCTATCGCGTCCACCAGTTCGAGAAGGTGGAGCAATTCATTCTGACCGAGCCGGAGAAA
TCTTGGGAAGCACTCGACGAAATGATGTCTACGTCGGAAGAGTTTTACCAGTCATTGAGGCTTCCCTACCAAGTG
ATTGCTATTGTCTCGGGCGCACTAAACAATGCTGCATCCAAAAAACTCGATCTTGAGGCATGGTTTCCCTTTCAA
GGCGAGTATAAAGAACTTGTTTCCTGCTCCAACTGTACAGACTACCAATCGCGCGCTCTTGAGATTCGCTACGGC
TCCAAGACAGTGACGGACACCAAAAAGAAGTATGTACATTGTCTCAACGCCACATTATGTGCCACGACGAGAACA
TTATGCTGCATTCTAGAGAACTACCAAACGGAAGAAGGCTTTCGGGTACCCGACCCGCTCCGCAAGTATTTGCCT
GGGACGCCAGACTTTATTCCCTTCTCTAAGGAGCTCCCCAAAGATTCGACGTCGCAAAAAGCACTGCCGAACCGA
CCAAAGGGCGGTAAATGA
Transcript >OphauG2|7586
ATGCTCGGTGTTAGACGTGATAGCAAGCCGTTCATATCTGGATATTATCGAGGACCGAGCAGCAGTATGCTCGAC
GTGGTAGATTTCATCAAGGAGCGTGGTGGCGACCCGGAAAAAATTCGCGAATCACAACGGCGCCGTAACGCCAGC
GTCGAAGTTGTTGACGAGGTCATAGCTCTCTTTGAGGACCATCGCAAGACCAATTACAGCGCTAGCCAGACCAAC
AGTAAAATCAACGACATCCAAAAGCAAATTGGAGCAAAAAAGAAGGCCAAAGAAAATGCCGACGACCTGTTGAAA
CAGAAAGTCGAACTGGAAAAGGAAAAGAAAAGCCTAGTAGAATCGGCCGCAGAAAAGGAAGTCCAGCTCAAGTCC
AAGATTAAGACGATTGGCAACTATGTCCACGACTCGGTTCCTGTCAGCAACAACGAGGATAACAACGAGGTGCTT
CGTACGTGGGCCCCTGAGGGTGTCACGGTCGAGAAGCGCAACGTACTATCACACCACGAGGTTCTCCTACGCCTC
GACGGCTATGACCCTGACCGTGGCGTCAAGGTTGTTGGACATCGCGGTTACTTCTTGCGCCAATGGGGTGTCTTT
TTGAACCAGGCTCTCATCAACTATGGCCTCGAGTTCCTCTCTCAACGTGGATACACTGCCCTGCAGGCACCTCAA
TTCATGCTCAAGGAGTATATGGCCAAGACGGCGCAACTCGAGGATTTCGATGAGGAGCTCTACAAGGTGGTGGAC
GGCGAGGCAAAGAATGACAAGTACCTAATAGCAACGTCGGAGCAGCCCATTTCAGCCTTTCATGCCGATGAATGG
CTTATTGCCAAGGACTTGCCAATCAAGTATGCTGGTTTCAGCTCATGCTATAGACGTGAGGCTGGCTCCCACGGC
CGCGATGCCTGGGGCATCTATCGCGTCCACCAGTTCGAGAAGGTGGAGCAATTCATTCTGACCGAGCCGGAGAAA
TCTTGGGAAGCACTCGACGAAATGATGTCTACGTCGGAAGAGTTTTACCAGTCATTGAGGCTTCCCTACCAAGTG
ATTGCTATTGTCTCGGGCGCACTAAACAATGCTGCATCCAAAAAACTCGATCTTGAGGCATGGTTTCCCTTTCAA
GGCGAGTATAAAGAACTTGTTTCCTGCTCCAACTGTACAGACTACCAATCGCGCGCTCTTGAGATTCGCTACGGC
TCCAAGACAGTGACGGACACCAAAAAGAAGTATGTACATTGTCTCAACGCCACATTATGTGCCACGACGAGAACA
TTATGCTGCATTCTAGAGAACTACCAAACGGAAGAAGGCTTTCGGGTACCCGACCCGCTCCGCAAGTATTTGCCT
GGGACGCCAGACTTTATTCCCTTCTCTAAGGAGCTCCCCAAAGATTCGACGTCGCAAAAAGCACTGCCGAACCGA
CCAAAGGGCGGTAAATGA
Gene >OphauG2|7586
ATGCTCGGTGTTAGACGTGATAGCAAGCCGTTCATATCTGGGTAGGTCGCTTGCCATGCAAGTCTATAAACTCTC
AATTGACCCTGAAATTATAGATATTATCGAGGACCGAGTAATATTGCAATTACAGAACGAGACAATCAGAAGGCG
AATAATCGAGTGTAGGCAGCAGTATGCTCGACGTGGTAGATTTCATCAAGGAGCGTGGTGGCGACCCGGAAAAAA
TTCGCGAATCACAACGGCGCCGTAACGCCAGCGTCGAAGTTGTTGACGAGGTCATAGCTCTCTTTGAGGACCATC
GCAAGAGTGCGGATGCCTTCCCACCCTTGTCCCAAGTTCAAGCGACAATAGTCTGACGTTCACAGCCAATTACAG
CGCTAGCCAGACCAACAGTAAAATCAACGACATCCAAAAGCAAATTGGAGCAAAAAAGAAGGTGTCAAGCCCAAT
GAAGCAAATCCACTTGTCTCTTTGTCACTCGACTCTAGCTAACTAGCAGTAATATATGAATAGGCCAAAGAAAAT
GCCGACGACCTGTTGAAACAGAAAGTCGAACTGGAAAAGGAAAAGAAAAGCCTAGTAGAATCGGCCGCAGAAAAG
GAAGTCCAGCTCAAGTCCAAGATTAAGACGATTGGCAACTATGTCCACGACTCGGTTCCTGTCAGCAACAACGAG
GTATACAGCTACACGCCGACTACGCCAGAGGGTGTGTCTGTTGACGTGTACTTGGCTGAATAGGATAACAACGAG
GTGCTTCGTACGTGGGCCCCTGAGGGTGTCACGGTCGAGAAGCGCAACGTACTATCACACCACGAGGTTCTCCTA
CGCCTCGACGGCTATGACCCTGACCGTGGCGTCAAGGTTGTTGGACATCGCGGTTACTTCTTGCGCCAATGGGGT
GTCTTTTTGAACCAGGCTCTCATCAACTATGGCCTCGAGTTCCTCTCTCAACGTGGATACACTGCCCTGCAGGCA
CCTCAATTCATGCTCAAGGAGTATATGGCCAAGACGGCGCAACTCGAGGATTTCGATGAGGAGCTCTACAAGGTG
GTGGACGGCGAGGCAAAGAATGACAAGTACCTAATAGCAACGTCGGAGCAGCCCATTTCAGCCTTTCATGCCGAT
GAATGGCTTATTGCCAAGGACTTGCCAATCAAGTAAGCCGACAAGAGGAGGCACCGAATGGACCCTTGATGGCAC
TTGCTGACCATTTATGCTAGGTATGCTGGTTTCAGCTCATGCTATAGACGTGAGGCTGGCTCCCACGGCCGCGAT
GCCTGGGGCATCTATCGCGTCCACCAGTTCGAGAAGGCAAGTTGTCTACACGTCTTATCGCCTCTGATTTCGGCC
CGAGCAGCCAACAGACTAACGCCAAAGACCAGGTGGAGCAATTCATTCTGACCGAGCCGGAGAAATCTTGGGAAG
CACTCGACGAAATGATGTCTACGTCGGAAGAGTTTTACCAGTCATTGAGGCTTCCCTACCAAGTGATTGCTATTG
TCTCGGGCGCACTAAACAATGCTGCATCCAAAAAACTCGATCTTGAGGCATGGTTTCCCTTTCAAGGCGAGTATA
AAGAACTTGTTTCCTGCTCCAACTGTACAGACTACCAATCGCGCGCTCTTGAGATTCGCTACGGCTCCAAGACAG
TGACGGACACCAAAAAGAAGTATGTACATTGTCTCAACGCCACATTATGTGCCACGACGAGAACATTATGCTGCA
TTCTAGAGAACTACCAAACGGAAGAAGTGAGTTTTGTAGCTGTGTCTCATGGCTTAGCCAAAGCTGGTTCTAACC
CATTGAACCGCAGGGCTTTCGGGTACCCGACCCGCTCCGCAAGTATTTGCCTGGGACGCCAGACTTTATTCCCTT
CTCTAAGGAGCTCCCCAAAGATTCGACGTCGCAAAAAGCACTGCCGAACCGACCAAAGGGCGGTAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail