Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7580
Gene name
LocationContig_9:46281..47887
Strand+
Gene length (bp)1606
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00956 NAP Nucleosome assembly protein (NAP) 1.4E-100 87 353

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59797|YCO6_SCHPO Putative nucleosome assembly protein C364.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC364.06 PE=1 SV=1 5 360 4.0E-115
sp|Q5AAI8|NAP1_CANAL Nucleosome assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NAP1 PE=1 SV=1 3 358 4.0E-108
sp|P78920|YGNB_SCHPO Putative nucleosome assembly protein C2D10.11C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.11c PE=2 SV=2 12 383 1.0E-95
sp|P25293|NAP1_YEAST Nucleosome assembly protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAP1 PE=1 SV=2 1 409 7.0E-90
sp|Q28EB4|NP1L1_XENTR Nucleosome assembly protein 1-like 1 OS=Xenopus tropicalis GN=nap1l1 PE=2 SV=1 55 351 5.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59797|YCO6_SCHPO Putative nucleosome assembly protein C364.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC364.06 PE=1 SV=1 5 360 4.0E-115
sp|Q5AAI8|NAP1_CANAL Nucleosome assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NAP1 PE=1 SV=1 3 358 4.0E-108
sp|P78920|YGNB_SCHPO Putative nucleosome assembly protein C2D10.11C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.11c PE=2 SV=2 12 383 1.0E-95
sp|P25293|NAP1_YEAST Nucleosome assembly protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAP1 PE=1 SV=2 1 409 7.0E-90
sp|Q28EB4|NP1L1_XENTR Nucleosome assembly protein 1-like 1 OS=Xenopus tropicalis GN=nap1l1 PE=2 SV=1 55 351 5.0E-62
sp|Q7ZY81|NPL1B_XENLA Nucleosome assembly protein 1-like 1-B OS=Xenopus laevis GN=nap1l1-b PE=1 SV=1 55 351 1.0E-61
sp|Q78ZA7|NP1L4_MOUSE Nucleosome assembly protein 1-like 4 OS=Mus musculus GN=Nap1l4 PE=1 SV=1 55 355 7.0E-59
sp|Q5U2Z3|NP1L4_RAT Nucleosome assembly protein 1-like 4 OS=Rattus norvegicus GN=Nap1l4 PE=1 SV=1 55 355 3.0E-58
sp|B8AW64|NAP1B_ORYSI Nucleosome assembly protein 1;2 OS=Oryza sativa subsp. indica GN=NAP1;2 PE=1 SV=1 59 361 2.0E-57
sp|Q53WK4|NAP1B_ORYSJ Nucleosome assembly protein 1;2 OS=Oryza sativa subsp. japonica GN=NAP1;2 PE=2 SV=1 59 361 2.0E-57
sp|Q70Z17|NAP1C_TOBAC Nucleosome assembly protein 1;3 OS=Nicotiana tabacum GN=NAP1;3 PE=1 SV=1 59 354 4.0E-57
sp|Q70Z18|NAP1B_TOBAC Nucleosome assembly protein 1;2 OS=Nicotiana tabacum GN=NAP1;2 PE=1 SV=1 59 354 8.0E-57
sp|P28656|NP1L1_MOUSE Nucleosome assembly protein 1-like 1 OS=Mus musculus GN=Nap1l1 PE=1 SV=2 55 351 2.0E-56
sp|Q9SZI2|NAP1A_ARATH Nucleosome assembly protein 1;1 OS=Arabidopsis thaliana GN=NAP1;1 PE=1 SV=1 59 355 3.0E-56
sp|Q4U0Y4|NPL1A_XENLA Nucleosome assembly protein 1-like 1-A OS=Xenopus laevis GN=nap1l1-a PE=1 SV=1 55 351 7.0E-56
sp|Q2TA40|NP1L4_BOVIN Nucleosome assembly protein 1-like 4 OS=Bos taurus GN=NAP1L4 PE=2 SV=1 55 355 1.0E-55
sp|A6H767|NP1L1_BOVIN Nucleosome assembly protein 1-like 1 OS=Bos taurus GN=NAP1L1 PE=2 SV=1 55 351 2.0E-55
sp|P55209|NP1L1_HUMAN Nucleosome assembly protein 1-like 1 OS=Homo sapiens GN=NAP1L1 PE=1 SV=1 55 351 2.0E-55
sp|Q99733|NP1L4_HUMAN Nucleosome assembly protein 1-like 4 OS=Homo sapiens GN=NAP1L4 PE=1 SV=1 55 355 3.0E-55
sp|Q5R4D4|NP1L1_PONAB Nucleosome assembly protein 1-like 1 OS=Pongo abelii GN=NAP1L1 PE=2 SV=1 55 351 3.0E-55
sp|Q70Z19|NAP1A_TOBAC Nucleosome assembly protein 1;1 OS=Nicotiana tabacum GN=NAP1;1 PE=1 SV=1 59 354 2.0E-54
sp|Q9ZUP3|NAP1B_ARATH Nucleosome assembly protein 1;2 OS=Arabidopsis thaliana GN=NAP1;2 PE=1 SV=1 59 355 2.0E-54
sp|Q9Z2G8|NP1L1_RAT Nucleosome assembly protein 1-like 1 OS=Rattus norvegicus GN=Nap1l1 PE=1 SV=1 55 351 2.0E-54
sp|Q94K07|NAP1C_ARATH Nucleosome assembly protein 1;3 OS=Arabidopsis thaliana GN=NAP1;3 PE=1 SV=1 59 355 4.0E-53
sp|B9FU45|NAP1D_ORYSJ Nucleosome assembly protein 1-like 4 OS=Oryza sativa subsp. japonica GN=Os06g0611700 PE=3 SV=2 59 360 1.0E-52
sp|Q5VND6|NAP1A_ORYSJ Nucleosome assembly protein 1;1 OS=Oryza sativa subsp. japonica GN=NAP1;1 PE=2 SV=1 59 355 1.0E-52
sp|B8B2R4|NAP1A_ORYSI Nucleosome assembly protein 1;1 OS=Oryza sativa subsp. indica GN=NAP1;1 PE=1 SV=1 59 355 1.0E-51
sp|A2ZX50|NAP1C_ORYSJ Nucleosome assembly protein 1;3 OS=Oryza sativa subsp. japonica GN=NAP1;3 PE=3 SV=1 59 360 9.0E-51
sp|Q5MGA9|NAP1C_ORYSI Nucleosome assembly protein 1;3 OS=Oryza sativa subsp. indica GN=NAP1;3 PE=1 SV=2 55 360 1.0E-50
sp|B8B4K9|NAF1D_ORYSI Nucleosome assembly protein 1-like 4 OS=Oryza sativa subsp. indica GN=OsI_23686 PE=3 SV=2 59 360 2.0E-50
sp|Q70Z16|NAP1D_TOBAC Nucleosome assembly protein 1;4 OS=Nicotiana tabacum GN=NAP1;4 PE=1 SV=1 59 354 4.0E-46
sp|P51860|NP1L2_MOUSE Nucleosome assembly protein 1-like 2 OS=Mus musculus GN=Nap1l2 PE=2 SV=2 65 355 1.0E-41
sp|Q9ULW6|NP1L2_HUMAN Nucleosome assembly protein 1-like 2 OS=Homo sapiens GN=NAP1L2 PE=1 SV=1 65 355 2.0E-41
sp|F4JEI8|NAP1D_ARATH Nucleosome assembly protein 1;4 OS=Arabidopsis thaliana GN=NAP1;4 PE=1 SV=1 78 356 1.0E-35
sp|Q55ED1|NAP1_DICDI Probable nucleosome assembly protein OS=Dictyostelium discoideum GN=nap1 PE=2 SV=1 83 354 3.0E-28
sp|Q924R9|NP1L3_RAT Nucleosome assembly protein 1-like 3 OS=Rattus norvegicus GN=Nap1l3 PE=2 SV=1 177 353 8.0E-24
sp|Q794H2|NP1L3_MOUSE Nucleosome assembly protein 1-like 3 OS=Mus musculus GN=Nap1l3 PE=2 SV=1 166 353 1.0E-23
sp|Q5R675|NP1L3_PONAB Nucleosome assembly protein 1-like 3 OS=Pongo abelii GN=NAP1L3 PE=2 SV=1 177 354 3.0E-21
sp|Q99457|NP1L3_HUMAN Nucleosome assembly protein 1-like 3 OS=Homo sapiens GN=NAP1L3 PE=2 SV=2 177 354 8.0E-21
sp|Q8LC68|NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana GN=NRP2 PE=1 SV=2 78 352 3.0E-16
sp|Q9EQU5|SET_MOUSE Protein SET OS=Mus musculus GN=Set PE=1 SV=1 95 350 5.0E-11
sp|Q63945|SET_RAT Protein SET OS=Rattus norvegicus GN=Set PE=2 SV=2 95 350 5.0E-11
sp|Q01105|SET_HUMAN Protein SET OS=Homo sapiens GN=SET PE=1 SV=3 95 350 6.0E-11
sp|Q7X7C9|NRP1_ORYSJ NAP1-related protein 1 OS=Oryza sativa subsp. japonica GN=Os04g0459700 PE=2 SV=1 79 353 4.0E-09
sp|A2XU85|NRP1_ORYSI NAP1-related protein 1 OS=Oryza sativa subsp. indica GN=H0219H12.3 PE=3 SV=1 79 353 4.0E-09
sp|Q18240|SPR2_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans GN=spr-2 PE=2 SV=2 84 247 6.0E-09
sp|P0CV98|TSPY3_HUMAN Testis-specific Y-encoded protein 3 OS=Homo sapiens GN=TSPY3 PE=3 SV=1 175 305 2.0E-08
sp|Q9UJ04|TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens GN=TSPYL4 PE=1 SV=2 175 305 2.0E-08
sp|P0CV99|TSPY4_HUMAN Testis-specific Y-encoded protein 4 OS=Homo sapiens GN=TSPY4 PE=3 SV=1 175 305 2.0E-08
sp|P0CW01|TSPYA_HUMAN Testis-specific Y-encoded protein 10 OS=Homo sapiens GN=TSPY10 PE=3 SV=1 175 305 2.0E-08
sp|Q9CA59|NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana GN=NRP1 PE=1 SV=1 144 354 5.0E-08
sp|Q8VD63|TSYL4_MOUSE Testis-specific Y-encoded-like protein 4 OS=Mus musculus GN=Tspyl4 PE=1 SV=1 175 305 7.0E-08
sp|Q01534|TSPY1_HUMAN Testis-specific Y-encoded protein 1 OS=Homo sapiens GN=TSPY1 PE=1 SV=4 175 305 1.0E-07
sp|Q69JW2|NRP2_ORYSJ NAP1-related protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0576700 PE=2 SV=1 89 350 1.0E-07
sp|A6NKD2|TSPY2_HUMAN Testis-specific Y-encoded protein 2 OS=Homo sapiens GN=TSPY2 PE=3 SV=1 175 305 1.0E-07
sp|B8AEC1|NRP2_ORYSI NAP1-related protein 2 OS=Oryza sativa subsp. indica GN=OsI_07785 PE=2 SV=1 89 350 2.0E-07
sp|P0DME0|SETLP_HUMAN Protein SETSIP OS=Homo sapiens GN=SETSIP PE=1 SV=1 95 305 2.0E-07
sp|P0CW00|TSPY8_HUMAN Testis-specific Y-encoded protein 8 OS=Homo sapiens GN=TSPY8 PE=3 SV=2 175 305 4.0E-07
sp|A6NFF2|NP1L6_HUMAN Putative nucleosome assembly protein 1-like 6 OS=Homo sapiens GN=NAP1L6 PE=5 SV=1 77 142 4.0E-07
sp|Q5PPG6|NP1L5_RAT Nucleosome assembly protein 1-like 5 OS=Rattus norvegicus GN=Nap1l5 PE=2 SV=1 77 137 2.0E-06
sp|P53997|SET_DROME Protein SET OS=Drosophila melanogaster GN=Set PE=1 SV=2 94 317 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006334 nucleosome assembly Yes
GO:0005634 nucleus Yes
GO:0043227 membrane-bounded organelle No
GO:0065003 protein-containing complex assembly No
GO:0022607 cellular component assembly No
GO:0043933 protein-containing complex organization No
GO:0043226 organelle No
GO:0006338 chromatin remodeling No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008150 biological_process No
GO:0065004 protein-DNA complex assembly No
GO:0034728 nucleosome organization No
GO:0016043 cellular component organization No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0071824 protein-DNA complex subunit organization No
GO:0071840 cellular component organization or biogenesis No
GO:0110165 cellular anatomical entity No
GO:0006325 chromatin organization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2849
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7580 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3735
Ophiocordyceps camponoti-floridani Ophcf2|04728
Ophiocordyceps camponoti-rufipedis Ophun1|7090
Ophiocordyceps kimflemingae Ophio5|8462
Ophiocordyceps subramaniannii Hirsu2|4671

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7580
MAEPIRNKRPDLAAPTPQNTPASNAPISSHAQQPGVASIKEEDMDRATAASIFAKNPKLVQMIEGRLGSLIGRSS
GYIESLPTPVRRRVAGLRAIQKDHAKLEAEFQDEVLQLEKKYFAKFTPLYQKRADIVNGKMEPTEEEVKAGDEDE
DGDKKDQATTAADGEKPQSDMPDNVSGIPEFWLSAMKNQVTLAEMITDRDEAALKHLTDIRMEYLEKPGFRLIFE
FAPNDFFPNKTITKTYYYQTESGYGGDFIYDHAEGDKIDWYPDKDLTVRVESKKQRNKTTKQTRIIKRTVPTESF
FNFFSPPKPPADDEDADEDTASDIEDRLELDYQLGEDIKEKLIPRAIHWFTGEALAFEEFEEDDIDGAYEDDDDD
EEDELSEEQDEDEESDEDDDSGKPKQEPSECKQS*
Coding >OphauG2|7580
ATGGCCGAACCTATCCGAAACAAGCGTCCCGACCTGGCGGCTCCCACGCCTCAAAACACACCTGCCAGCAATGCG
CCCATCTCGTCCCATGCGCAGCAGCCCGGCGTGGCTAGCATCAAAGAAGAGGACATGGATCGTGCTACCGCTGCC
TCCATCTTTGCCAAGAACCCTAAGCTGGTGCAAATGATTGAGGGCCGACTTGGTTCGTTGATTGGTCGATCATCT
GGCTATATCGAATCTTTGCCCACGCCTGTACGTCGTCGAGTTGCTGGCCTGAGGGCTATCCAGAAGGACCATGCG
AAGCTCGAAGCCGAATTCCAGGATGAGGTTCTTCAGCTTGAGAAGAAGTATTTTGCAAAATTCACCCCCTTGTAC
CAGAAGCGTGCCGATATTGTTAATGGAAAGATGGAGCCGACCGAAGAAGAGGTCAAGGCTGGCGACGAAGATGAA
GACGGCGACAAGAAGGACCAAGCAACGACTGCCGCTGATGGCGAGAAGCCGCAATCTGACATGCCCGACAATGTT
TCTGGTATTCCCGAGTTTTGGTTGTCGGCCATGAAGAATCAGGTCACGCTCGCCGAAATGATTACCGATCGCGAC
GAGGCAGCTCTGAAACACCTGACGGATATTCGCATGGAGTATCTTGAAAAGCCTGGTTTCCGCCTCATTTTTGAG
TTTGCTCCCAATGATTTCTTCCCAAACAAGACCATCACCAAGACGTACTACTATCAAACGGAAAGCGGTTACGGT
GGAGACTTCATATATGACCATGCCGAGGGCGACAAGATCGACTGGTATCCCGATAAGGACTTGACTGTTCGCGTC
GAGAGCAAGAAGCAGCGAAATAAGACCACAAAGCAGACCCGTATCATCAAGAGGACCGTGCCCACCGAGTCTTTT
TTCAACTTTTTCTCCCCGCCCAAGCCACCTGCGGACGATGAAGATGCGGACGAGGATACTGCCTCGGACATTGAA
GACCGCCTCGAGCTTGACTACCAACTTGGCGAGGATATCAAGGAGAAGTTGATTCCCCGCGCTATTCACTGGTTC
ACGGGTGAAGCCTTGGCCTTTGAGGAGTTTGAGGAGGACGATATCGACGGCGCCTATGAAGATGACGATGATGAC
GAGGAGGACGAGCTGAGTGAGGAACAGGATGAGGACGAAGAGTCTGACGAAGATGACGACTCAGGCAAGCCTAAG
CAGGAACCATCCGAGTGCAAGCAGAGCTGA
Transcript >OphauG2|7580
ATGGCCGAACCTATCCGAAACAAGCGTCCCGACCTGGCGGCTCCCACGCCTCAAAACACACCTGCCAGCAATGCG
CCCATCTCGTCCCATGCGCAGCAGCCCGGCGTGGCTAGCATCAAAGAAGAGGACATGGATCGTGCTACCGCTGCC
TCCATCTTTGCCAAGAACCCTAAGCTGGTGCAAATGATTGAGGGCCGACTTGGTTCGTTGATTGGTCGATCATCT
GGCTATATCGAATCTTTGCCCACGCCTGTACGTCGTCGAGTTGCTGGCCTGAGGGCTATCCAGAAGGACCATGCG
AAGCTCGAAGCCGAATTCCAGGATGAGGTTCTTCAGCTTGAGAAGAAGTATTTTGCAAAATTCACCCCCTTGTAC
CAGAAGCGTGCCGATATTGTTAATGGAAAGATGGAGCCGACCGAAGAAGAGGTCAAGGCTGGCGACGAAGATGAA
GACGGCGACAAGAAGGACCAAGCAACGACTGCCGCTGATGGCGAGAAGCCGCAATCTGACATGCCCGACAATGTT
TCTGGTATTCCCGAGTTTTGGTTGTCGGCCATGAAGAATCAGGTCACGCTCGCCGAAATGATTACCGATCGCGAC
GAGGCAGCTCTGAAACACCTGACGGATATTCGCATGGAGTATCTTGAAAAGCCTGGTTTCCGCCTCATTTTTGAG
TTTGCTCCCAATGATTTCTTCCCAAACAAGACCATCACCAAGACGTACTACTATCAAACGGAAAGCGGTTACGGT
GGAGACTTCATATATGACCATGCCGAGGGCGACAAGATCGACTGGTATCCCGATAAGGACTTGACTGTTCGCGTC
GAGAGCAAGAAGCAGCGAAATAAGACCACAAAGCAGACCCGTATCATCAAGAGGACCGTGCCCACCGAGTCTTTT
TTCAACTTTTTCTCCCCGCCCAAGCCACCTGCGGACGATGAAGATGCGGACGAGGATACTGCCTCGGACATTGAA
GACCGCCTCGAGCTTGACTACCAACTTGGCGAGGATATCAAGGAGAAGTTGATTCCCCGCGCTATTCACTGGTTC
ACGGGTGAAGCCTTGGCCTTTGAGGAGTTTGAGGAGGACGATATCGACGGCGCCTATGAAGATGACGATGATGAC
GAGGAGGACGAGCTGAGTGAGGAACAGGATGAGGACGAAGAGTCTGACGAAGATGACGACTCAGGCAAGCCTAAG
CAGGAACCATCCGAGTGCAAGCAGAGCTGA
Gene >OphauG2|7580
ATGGCCGAACCTATCCGAAACAAGCGTCCCGACCTGGCGGCTCCGTGAGTGTGCCCCTCTCCTCTTTTCCCCCCT
CCCTTGCTCCCCTTCTCAGCCACGCCGTCTTTGCATGTTGCTCTGCTCTGAAATGAGGGTGTCTTGATGGACCCT
ATACTGCATCACATGGACATGGAAGCTGACCCGCCTTGTCTTGGCCCTCAGCACGCCTCAAAACACACCTGCCAG
CAATGCGCCCATCTCGTCCCATGCGCAGCAGCCCGGCGTGGCTAGCATCAAAGAAGGTGAGCAGTGATTGGCCCC
GTGACTCCTGTCAGCCCTTGTTGCCCCAGCCTCCAACTGACCTTGTCGTCTCGCCTTTGCTGCAGAGGACATGGA
TCGTGCTACCGCTGCCTCCATCTTTGCCAAGAACCCTAAGCTGGTGCAAATGATTGAGGGCCGACTTGGTTCGTT
GATTGGTCGATCATCTGGCTATATCGAATCTTTGCCCACGCCTGTACGTCGTCGAGTTGCTGGCCTGAGGGCTAT
CCAGAAGGACCATGCGAAGCTCGAAGCCGAATTCCAGGATGAGGTTCTTCAGCTTGAGAAGAAGTATTTTGCAAA
ATTCACCCCCTTGTACCAGAAGCGTGCCGATATTGTTAATGGAAAGATGGAGCCGACCGAAGAAGAGGTCAAGGC
TGGCGACGAAGATGAAGACGGCGACAAGAAGGACCAAGCAACGACTGCCGCTGATGGCGAGAAGCCGCAATCTGA
CATGCCCGACAATGTTTCTGGTATTCCCGAGTTTTGGTTGTCGGCCATGAAGAATCAGGTCACGCTCGCCGAAAT
GATTACCGATCGCGACGAGGCAGCTCTGAAACACCTGACGGATATTCGCATGGAGTATCTTGAAAAGCCTGGTTT
CCGCCTCATTTTTGAGTTTGCTCCCAATGATTTCTTCCCAAACAAGACCATCACCAAGACGTACTACTATCAAAC
GGAAAGCGGTTACGGTGGAGACTTCATATATGACCATGCCGAGGGCGACAAGATCGACTGGTATCCCGATAAGGA
CTTGACTGTTCGCGTCGAGAGCAAGAAGCAGCGAAATAAGAGTGGGTTTTGAGTGCCATGAGACTGACTACGATA
ATTATTGTCTCTAACATACTTGGACAGCCACAAAGCAGACCCGTATCATCAAGAGGACCGTGCCCACCGAGTCTT
TTTTCAACTTTTTCTCCCCGCCCAAGCCACCTGCGGACGATGAAGATGCGGACGAGGATACTGCCTCGGACATTG
AAGACCGCCTCGAGCTTGACTACCAACTTGGCGAGGATATCAAGGAGAAGTTGATTCCCCGCGCTATTCACTGGT
TCACGGGTGAAGCCTTGGCCTTTGAGGAGTTTGAGGAGGACGATATCGACGGCGCCTATGAAGATGACGATGATG
ACGAGGAGGACGAGCTGAGTGAGGAACAGGATGAGGACGAAGAGTCTGACGAAGATGTGAGCGAGCGCCTTTTGA
CATGTTCTATCTCGAGTATATGCAAAGTGTGTGGGTGCTAATACAGCGAAAACAGGACGACTCAGGCAAGCCTAA
GCAGGAACCATCCGAGTGCAAGCAGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail