Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|758
Gene name
LocationContig_12:6106..9334
Strand-
Gene length (bp)3228
Transcript length (bp)3054
Coding sequence length (bp)3054
Protein length (aa) 1018

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1991
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|758 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4379
Ophiocordyceps camponoti-floridani Ophcf2|02272
Ophiocordyceps camponoti-rufipedis Ophun1|3175
Ophiocordyceps kimflemingae Ophio5|5107
Ophiocordyceps subramaniannii Hirsu2|221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|758
MRHCLAAVSRLADACPDVCLAGIGSDSATLNWTRAPSSRPVKKYMIQVNGVYVGDSPGKDVAITVIGLRPYHFYT
LRVIAVGPNNFRAGSRPIRIQTFAKDGKPVLGDSRIPPNFVDSHPPMAESDEESDRSDTLTPSLPPVHDKNSTVT
REQGPSGPGQRRNTMNRRHSPSIASTDQQPTRSTPSSEPELSLAELNERFEGIRREIEDTVVQFSRDESEFQQQE
DELRRERDRKRQMLKEKEEQTTQLKTMIRTTMEQMRAAEKERTKKEQLLKDKETKKAKIRESIIKFESDLARMRS
QREGFETQKAQWAESKDQDLRKLEQDNSELQESCTKLEAELKDKGKQLQDLKATRIKLPGADEDKWREEEIRIRR
IWEIQRREIHQQLVLEVKEGHKLDQRIREISDHLAMQQQRAVALGFYSQPSSAPGKRPSHHSHALSKTGLPSPDR
LPHVEHGFHPGVGFANTSFAQRHFIDVAADGTSEGPSDADLRAVSGPLSPSAQSLLPSNIFEETEADSMPKARQL
AESTAGGDEGSRSPTSPTLSFNAFSSPHSSTQNLALQQYMDQSDAKSLRVSPGPDAHGATSHRFATFLSSLQRGR
GAKTEDDDGPPIGSLKPGQSQSFPTVADADESQTTRRRGNFYSWMTQGRLSPATPMAEARQLSALRPGLRQGSPA
IALADLESELSRPASIASLDVARPSTDSGSIWGAPPDGSGLSKHRLWSPSDGRWLSRSASRRPSLQGCNAPTTTL
ASADDEILDEDDLLNPESLPSQIGVIGSRPPGSASNQRLNPAAPTFMATIFRKDKDRAKDKTKEDRARDKTKEDK
ARAKEDRAKAREELQQACDDSHSDSRASRDTYSLHTQTSVSESRESLQLDSAPSNPLADVASSPSVKDSSENVVR
KLFRKGSSSKFGLSARLGKDSGLFKKSPGSAANSERNASADRPSSVGDADDLGDDGAALGRSYDSMASSTSSKPA
KEAGRMSSWRWSMSSIKKKGKESSSAAREKESLELERAPDEE*
Coding >OphauG2|758
ATGCGCCATTGTCTGGCTGCTGTATCGCGCCTGGCAGACGCTTGTCCCGATGTGTGTCTGGCCGGCATAGGCTCA
GATTCGGCCACTCTCAACTGGACCAGAGCGCCCTCGAGCCGCCCCGTCAAGAAGTACATGATTCAAGTCAATGGC
GTCTACGTGGGCGACTCACCCGGCAAGGATGTTGCCATTACTGTTATTGGACTCCGACCATATCACTTTTACACT
TTGCGCGTCATCGCCGTCGGCCCCAACAACTTTCGCGCGGGCAGCCGGCCCATTCGCATCCAAACGTTTGCCAAA
GACGGAAAACCGGTGCTTGGCGACTCGCGCATACCCCCAAACTTTGTCGATTCCCACCCCCCCATGGCCGAAAGC
GACGAAGAGAGCGACAGATCCGACACCCTCACCCCCTCGCTCCCCCCAGTGCACGACAAGAATTCGACAGTAACC
CGCGAACAAGGTCCCTCGGGCCCCGGTCAGCGACGAAACACGATGAATCGACGGCATTCCCCTTCTATAGCCAGT
ACGGACCAGCAACCAACAAGATCAACACCAAGTTCCGAACCAGAATTGTCTTTGGCGGAGCTGAATGAGAGGTTC
GAGGGCATTCGCCGAGAAATTGAAGACACAGTGGTGCAATTCTCTAGAGATGAAAGCGAATTTCAGCAACAAGAG
GACGAACTCAGGAGAGAGAGGGATCGCAAGCGGCAGATGCTGAAGGAAAAGGAGGAACAGACGACTCAACTCAAA
ACCATGATACGGACAACAATGGAGCAAATGCGTGCAGCGGAAAAGGAGCGGACCAAGAAGGAGCAGCTGCTCAAG
GATAAGGAGACGAAAAAGGCCAAGATTCGAGAGAGCATCATCAAGTTTGAAAGCGACTTGGCGAGAATGAGGTCC
CAACGCGAGGGATTCGAAACACAAAAAGCACAATGGGCGGAGAGTAAGGATCAAGACTTGCGCAAGCTAGAGCAA
GACAATAGCGAGCTTCAGGAAAGCTGTACCAAGCTCGAGGCGGAGCTCAAGGACAAGGGGAAGCAGCTTCAGGAC
CTCAAGGCAACGCGCATCAAGCTGCCTGGAGCCGACGAGGACAAGTGGAGGGAAGAGGAAATACGAATCCGGAGG
ATATGGGAGATTCAGCGACGGGAAATCCACCAGCAGCTGGTGCTCGAGGTCAAGGAAGGCCACAAGCTGGACCAG
CGCATCCGCGAAATCAGCGACCACCTGGCCATGCAGCAGCAGCGAGCAGTGGCGCTCGGCTTCTACAGCCAGCCG
TCATCGGCTCCGGGCAAGCGGCCGAGCCACCACAGCCACGCCTTGAGCAAGACGGGCTTGCCTTCGCCTGACCGG
CTCCCTCATGTCGAGCACGGCTTCCACCCAGGCGTGGGATTCGCCAACACGTCGTTTGCTCAGCGTCACTTTATC
GACGTGGCAGCCGACGGCACCAGTGAGGGGCCAAGCGATGCTGATCTCCGAGCTGTGTCCGGGCCGCTTAGCCCG
TCGGCTCAGAGCCTGCTTCCATCCAACATCTTTGAGGAGACGGAAGCCGACTCAATGCCCAAGGCTCGTCAACTG
GCCGAGTCGACGGCGGGGGGCGATGAGGGATCGCGGTCGCCAACATCGCCCACGCTCTCCTTCAACGCCTTTTCC
AGTCCCCATAGCTCGACGCAGAATCTTGCTCTGCAGCAGTACATGGACCAGAGCGACGCAAAGTCGCTCCGCGTA
AGCCCTGGGCCCGACGCGCACGGCGCCACAAGTCACAGGTTTGCCACTTTTCTCTCTAGTTTACAGCGCGGCCGG
GGCGCCAAGACGGAAGACGACGACGGTCCCCCGATTGGGAGCCTCAAGCCGGGCCAGAGCCAGTCCTTTCCCACG
GTGGCTGATGCAGATGAGTCGCAGACTACTAGACGCCGCGGCAACTTTTACTCGTGGATGACTCAAGGCCGCCTG
TCGCCCGCCACTCCCATGGCGGAAGCAAGGCAGCTGTCGGCGCTGCGCCCGGGTCTGCGCCAGGGCTCGCCAGCC
ATTGCCCTTGCTGACTTGGAAAGCGAGCTCTCGCGGCCTGCTTCCATTGCGTCTTTGGATGTTGCGCGCCCGTCA
ACAGACAGCGGGTCTATTTGGGGAGCCCCTCCAGACGGAAGCGGCCTGAGCAAGCATCGCCTCTGGTCTCCCAGT
GACGGCCGCTGGCTCTCGAGGAGCGCTTCCCGACGCCCGTCGCTACAGGGATGCAACGCGCCGACAACGACACTG
GCCTCTGCCGACGACGAGATTCTCGACGAGGACGATCTCCTCAACCCCGAGTCGCTGCCCAGCCAAATCGGCGTC
ATTGGATCGCGGCCGCCCGGCTCGGCCTCGAACCAGCGCCTCAACCCTGCGGCCCCGACCTTTATGGCCACTATT
TTCCGCAAGGACAAGGATAGGGCCAAGGACAAGACCAAGGAGGACAGAGCCAGGGACAAGACCAAGGAAGACAAG
GCGAGGGCCAAGGAGGACAGGGCCAAGGCCAGGGAGGAGCTGCAACAGGCCTGCGACGACTCGCACTCGGACTCT
CGCGCCTCGCGCGACACGTACTCGCTGCACACGCAAACGTCGGTGTCCGAGTCTCGCGAGTCCCTACAGCTCGAC
TCGGCTCCCTCCAACCCGCTGGCCGACGTGGCGTCGTCGCCCAGCGTCAAGGACTCGTCGGAAAACGTGGTGCGC
AAGCTCTTCCGCAAGGGCAGCTCGAGCAAGTTTGGCCTATCGGCGCGCCTCGGCAAGGACTCGGGCCTGTTTAAG
AAGAGCCCCGGCAGTGCCGCAAACTCGGAGCGCAACGCGTCGGCAGACCGCCCCTCGAGCGTGGGCGACGCCGAC
GACTTGGGCGACGATGGCGCGGCCCTGGGACGCAGCTACGACAGCATGGCCAGCAGTACCTCGTCCAAGCCCGCC
AAGGAGGCTGGTAGGATGAGCTCGTGGCGCTGGTCCATGTCCTCGATTAAGAAGAAGGGAAAGGAGTCGTCGTCG
GCCGCCAGGGAAAAAGAAAGCCTCGAGCTTGAGCGAGCTCCAGATGAGGAATAG
Transcript >OphauG2|758
ATGCGCCATTGTCTGGCTGCTGTATCGCGCCTGGCAGACGCTTGTCCCGATGTGTGTCTGGCCGGCATAGGCTCA
GATTCGGCCACTCTCAACTGGACCAGAGCGCCCTCGAGCCGCCCCGTCAAGAAGTACATGATTCAAGTCAATGGC
GTCTACGTGGGCGACTCACCCGGCAAGGATGTTGCCATTACTGTTATTGGACTCCGACCATATCACTTTTACACT
TTGCGCGTCATCGCCGTCGGCCCCAACAACTTTCGCGCGGGCAGCCGGCCCATTCGCATCCAAACGTTTGCCAAA
GACGGAAAACCGGTGCTTGGCGACTCGCGCATACCCCCAAACTTTGTCGATTCCCACCCCCCCATGGCCGAAAGC
GACGAAGAGAGCGACAGATCCGACACCCTCACCCCCTCGCTCCCCCCAGTGCACGACAAGAATTCGACAGTAACC
CGCGAACAAGGTCCCTCGGGCCCCGGTCAGCGACGAAACACGATGAATCGACGGCATTCCCCTTCTATAGCCAGT
ACGGACCAGCAACCAACAAGATCAACACCAAGTTCCGAACCAGAATTGTCTTTGGCGGAGCTGAATGAGAGGTTC
GAGGGCATTCGCCGAGAAATTGAAGACACAGTGGTGCAATTCTCTAGAGATGAAAGCGAATTTCAGCAACAAGAG
GACGAACTCAGGAGAGAGAGGGATCGCAAGCGGCAGATGCTGAAGGAAAAGGAGGAACAGACGACTCAACTCAAA
ACCATGATACGGACAACAATGGAGCAAATGCGTGCAGCGGAAAAGGAGCGGACCAAGAAGGAGCAGCTGCTCAAG
GATAAGGAGACGAAAAAGGCCAAGATTCGAGAGAGCATCATCAAGTTTGAAAGCGACTTGGCGAGAATGAGGTCC
CAACGCGAGGGATTCGAAACACAAAAAGCACAATGGGCGGAGAGTAAGGATCAAGACTTGCGCAAGCTAGAGCAA
GACAATAGCGAGCTTCAGGAAAGCTGTACCAAGCTCGAGGCGGAGCTCAAGGACAAGGGGAAGCAGCTTCAGGAC
CTCAAGGCAACGCGCATCAAGCTGCCTGGAGCCGACGAGGACAAGTGGAGGGAAGAGGAAATACGAATCCGGAGG
ATATGGGAGATTCAGCGACGGGAAATCCACCAGCAGCTGGTGCTCGAGGTCAAGGAAGGCCACAAGCTGGACCAG
CGCATCCGCGAAATCAGCGACCACCTGGCCATGCAGCAGCAGCGAGCAGTGGCGCTCGGCTTCTACAGCCAGCCG
TCATCGGCTCCGGGCAAGCGGCCGAGCCACCACAGCCACGCCTTGAGCAAGACGGGCTTGCCTTCGCCTGACCGG
CTCCCTCATGTCGAGCACGGCTTCCACCCAGGCGTGGGATTCGCCAACACGTCGTTTGCTCAGCGTCACTTTATC
GACGTGGCAGCCGACGGCACCAGTGAGGGGCCAAGCGATGCTGATCTCCGAGCTGTGTCCGGGCCGCTTAGCCCG
TCGGCTCAGAGCCTGCTTCCATCCAACATCTTTGAGGAGACGGAAGCCGACTCAATGCCCAAGGCTCGTCAACTG
GCCGAGTCGACGGCGGGGGGCGATGAGGGATCGCGGTCGCCAACATCGCCCACGCTCTCCTTCAACGCCTTTTCC
AGTCCCCATAGCTCGACGCAGAATCTTGCTCTGCAGCAGTACATGGACCAGAGCGACGCAAAGTCGCTCCGCGTA
AGCCCTGGGCCCGACGCGCACGGCGCCACAAGTCACAGGTTTGCCACTTTTCTCTCTAGTTTACAGCGCGGCCGG
GGCGCCAAGACGGAAGACGACGACGGTCCCCCGATTGGGAGCCTCAAGCCGGGCCAGAGCCAGTCCTTTCCCACG
GTGGCTGATGCAGATGAGTCGCAGACTACTAGACGCCGCGGCAACTTTTACTCGTGGATGACTCAAGGCCGCCTG
TCGCCCGCCACTCCCATGGCGGAAGCAAGGCAGCTGTCGGCGCTGCGCCCGGGTCTGCGCCAGGGCTCGCCAGCC
ATTGCCCTTGCTGACTTGGAAAGCGAGCTCTCGCGGCCTGCTTCCATTGCGTCTTTGGATGTTGCGCGCCCGTCA
ACAGACAGCGGGTCTATTTGGGGAGCCCCTCCAGACGGAAGCGGCCTGAGCAAGCATCGCCTCTGGTCTCCCAGT
GACGGCCGCTGGCTCTCGAGGAGCGCTTCCCGACGCCCGTCGCTACAGGGATGCAACGCGCCGACAACGACACTG
GCCTCTGCCGACGACGAGATTCTCGACGAGGACGATCTCCTCAACCCCGAGTCGCTGCCCAGCCAAATCGGCGTC
ATTGGATCGCGGCCGCCCGGCTCGGCCTCGAACCAGCGCCTCAACCCTGCGGCCCCGACCTTTATGGCCACTATT
TTCCGCAAGGACAAGGATAGGGCCAAGGACAAGACCAAGGAGGACAGAGCCAGGGACAAGACCAAGGAAGACAAG
GCGAGGGCCAAGGAGGACAGGGCCAAGGCCAGGGAGGAGCTGCAACAGGCCTGCGACGACTCGCACTCGGACTCT
CGCGCCTCGCGCGACACGTACTCGCTGCACACGCAAACGTCGGTGTCCGAGTCTCGCGAGTCCCTACAGCTCGAC
TCGGCTCCCTCCAACCCGCTGGCCGACGTGGCGTCGTCGCCCAGCGTCAAGGACTCGTCGGAAAACGTGGTGCGC
AAGCTCTTCCGCAAGGGCAGCTCGAGCAAGTTTGGCCTATCGGCGCGCCTCGGCAAGGACTCGGGCCTGTTTAAG
AAGAGCCCCGGCAGTGCCGCAAACTCGGAGCGCAACGCGTCGGCAGACCGCCCCTCGAGCGTGGGCGACGCCGAC
GACTTGGGCGACGATGGCGCGGCCCTGGGACGCAGCTACGACAGCATGGCCAGCAGTACCTCGTCCAAGCCCGCC
AAGGAGGCTGGTAGGATGAGCTCGTGGCGCTGGTCCATGTCCTCGATTAAGAAGAAGGGAAAGGAGTCGTCGTCG
GCCGCCAGGGAAAAAGAAAGCCTCGAGCTTGAGCGAGCTCCAGATGAGGAATAG
Gene >OphauG2|758
ATGCGCCATTGTCTGGTTGGTTGCAGCTCTTGTCTTGCTTGTCTCGCTTCTAACCCCTCTGCTGTCCAGGCTGCT
GTATCGCGCCTGGCAGACGCTGTGGAGGCCAGTTCCCGAGCTCGTCAATGTTCTCGGCGTCGATGTTCCCCAGTG
TCCCGATGTGTGTCTGGCCGGCATAGGCTCAGATTCGGCCACTCTCAACTGGACCAGAGCGCCCTCGAGCCGCCC
CGTCAAGAAGTACATGATTCAAGTCAATGGCGTCTACGGTCAGTCAATCTAACCGCCCCGGGCGTCATCAGCTAT
TACAAGGTGCTCTGACCTACCTTTCTCACAGTGGGCGACTCACCCGGCAAGGATGTTGCCATTACTGTTATTGGA
CTCCGACCATATCACTTTTACACTTTGCGCGTCATCGCCGTCGGCCCCAACAACTTTCGCGCGGGCAGCCGGCCC
ATTCGCATCCAAACGTTTGCCAAAGACGGAAAACCGGTGCTTGGCGACTCGCGCATACCCCCAAACTTTGTCGAT
TCCCACCCCCCCATGGCCGAAAGCGACGAAGAGAGCGACAGATCCGACACCCTCACCCCCTCGCTCCCCCCAGTG
CACGACAAGAATTCGACAGTAACCCGCGAACAAGGTCCCTCGGGCCCCGGTCAGCGACGAAACACGATGAATCGA
CGGCATTCCCCTTCTATAGCCAGTACGGACCAGCAACCAACAAGATCAACACCAAGTTCCGAACCAGAATTGTCT
TTGGCGGAGCTGAATGAGAGGTTCGAGGGCATTCGCCGAGAAATTGAAGACACAGTGGTGCAATTCTCTAGAGAT
GAAAGCGAATTTCAGCAACAAGAGGACGAACTCAGGAGAGAGAGGGATCGCAAGCGGCAGATGCTGAAGGAAAAG
GAGGAACAGACGACTCAACTCAAAACCATGATACGGACAACAATGGAGCAAATGCGTGCAGCGGAAAAGGAGCGG
ACCAAGAAGGAGCAGCTGCTCAAGGATAAGGAGACGAAAAAGGCCAAGATTCGAGAGAGCATCATCAAGTTTGAA
AGCGACTTGGCGAGAATGAGGTCCCAACGCGAGGGATTCGAAACACAAAAAGCACAATGGGCGGAGAGTAAGGAT
CAAGACTTGCGCAAGCTAGAGCAAGACAATAGCGAGCTTCAGGAAAGCTGTACCAAGCTCGAGGCGGAGCTCAAG
GACAAGGGGAAGCAGCTTCAGGACCTCAAGGCAACGCGCATCAAGCTGCCTGGAGCCGACGAGGACAAGTGGAGG
GAAGAGGAAATACGAATCCGGAGGATATGGGAGATTCAGCGACGGGAAATCCACCAGCAGCTGGTGCTCGAGGTC
AAGGAAGGCCACAAGCTGGACCAGCGCATCCGCGAAATCAGCGACCACCTGGCCATGCAGCAGCAGCGAGCAGTG
GCGCTCGGCTTCTACAGCCAGCCGTCATCGGCTCCGGGCAAGCGGCCGAGCCACCACAGCCACGCCTTGAGCAAG
ACGGGCTTGCCTTCGCCTGACCGGCTCCCTCATGTCGAGCACGGCTTCCACCCAGGCGTGGGATTCGCCAACACG
TCGTTTGCTCAGCGTCACTTTATCGACGTGGCAGCCGACGGCACCAGTGAGGGGCCAAGCGATGCTGATCTCCGA
GCTGTGTCCGGGCCGCTTAGCCCGTCGGCTCAGAGCCTGCTTCCATCCAACATCTTTGAGGAGACGGAAGCCGAC
TCAATGCCCAAGGCTCGTCAACTGGCCGAGTCGACGGCGGGGGGCGATGAGGGATCGCGGTCGCCAACATCGCCC
ACGCTCTCCTTCAACGCCTTTTCCAGTCCCCATAGCTCGACGCAGAATCTTGCTCTGCAGCAGTACATGGACCAG
AGCGACGCAAAGTCGCTCCGCGTAAGCCCTGGGCCCGACGCGCACGGCGCCACAAGTCACAGGTTTGCCACTTTT
CTCTCTAGTTTACAGCGCGGCCGGGGCGCCAAGACGGAAGACGACGACGGTCCCCCGATTGGGAGCCTCAAGCCG
GGCCAGAGCCAGTCCTTTCCCACGGTGGCTGATGCAGATGAGTCGCAGACTACTAGACGCCGCGGCAACTTTTAC
TCGTGGATGACTCAAGGCCGCCTGTCGCCCGCCACTCCCATGGCGGAAGCAAGGCAGCTGTCGGCGCTGCGCCCG
GGTCTGCGCCAGGGCTCGCCAGCCATTGCCCTTGCTGACTTGGAAAGCGAGCTCTCGCGGCCTGCTTCCATTGCG
TCTTTGGATGTTGCGCGCCCGTCAACAGACAGCGGGTCTATTTGGGGAGCCCCTCCAGACGGAAGCGGCCTGAGC
AAGCATCGCCTCTGGTCTCCCAGTGACGGCCGCTGGCTCTCGAGGAGCGCTTCCCGACGCCCGTCGCTACAGGGA
TGCAACGCGCCGACAACGACACTGGCCTCTGCCGACGACGAGATTCTCGACGAGGACGATCTCCTCAACCCCGAG
TCGCTGCCCAGCCAAATCGGCGTCATTGGATCGCGGCCGCCCGGCTCGGCCTCGAACCAGCGCCTCAACCCTGCG
GCCCCGACCTTTATGGCCACTATTTTCCGCAAGGACAAGGATAGGGCCAAGGACAAGACCAAGGAGGACAGAGCC
AGGGACAAGACCAAGGAAGACAAGGCGAGGGCCAAGGAGGACAGGGCCAAGGCCAGGGAGGAGCTGCAACAGGCC
TGCGACGACTCGCACTCGGACTCTCGCGCCTCGCGCGACACGTACTCGCTGCACACGCAAACGTCGGTGTCCGAG
TCTCGCGAGTCCCTACAGCTCGACTCGGCTCCCTCCAACCCGCTGGCCGACGTGGCGTCGTCGCCCAGCGTCAAG
GACTCGTCGGAAAACGTGGTGCGCAAGCTCTTCCGCAAGGGCAGCTCGAGCAAGTTTGGCCTATCGGCGCGCCTC
GGCAAGGACTCGGGCCTGTTTAAGAAGAGCCCCGGCAGTGCCGCAAACTCGGAGCGCAACGCGTCGGCAGACCGC
CCCTCGAGCGTGGGCGACGCCGACGACTTGGGCGACGATGGCGCGGCCCTGGGACGCAGCTACGACAGCATGGCC
AGCAGTACCTCGTCCAAGCCCGCCAAGGAGGCTGGTAGGATGAGCTCGTGGCGCTGGTCCATGTCCTCGATTAAG
AAGAAGGGAAAGGAGTCGTCGTCGGCCGCCAGGGAAAAAGAAAGCCTCGAGCTTGAGCGAGCTCCAGATGAGGAA
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail