Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7578
Gene name
LocationContig_9:38561..39941
Strand-
Gene length (bp)1380
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.1E-35 63 333
PF08241 Methyltransf_11 Methyltransferase domain 9.8E-16 128 226
PF13649 Methyltransf_25 Methyltransferase domain 1.5E-14 127 222
PF13847 Methyltransf_31 Methyltransferase domain 2.5E-13 122 230
PF13489 Methyltransf_23 Methyltransferase domain 7.0E-10 117 254
PF08242 Methyltransf_12 Methyltransferase domain 9.6E-09 128 224
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.4E-07 116 236
PF05175 MTS Methyltransferase small domain 7.1E-07 124 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 12 345 6.0E-70
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 7 346 2.0E-69
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 7 345 5.0E-52
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 45 346 4.0E-51
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 10 346 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 12 345 6.0E-70
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 7 346 2.0E-69
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 7 345 5.0E-52
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 45 346 4.0E-51
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 10 346 2.0E-49
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 10 346 2.0E-49
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 21 346 2.0E-47
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 66 339 4.0E-25
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 66 339 4.0E-25
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 54 328 2.0E-18
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 54 328 2.0E-18
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 63 328 3.0E-18
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 63 328 3.0E-18
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 54 328 4.0E-18
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 68 328 1.0E-17
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 67 328 6.0E-17
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 67 328 8.0E-17
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 67 328 8.0E-17
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 67 340 6.0E-16
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 66 349 2.0E-15
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 67 340 2.0E-15
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 67 340 2.0E-15
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 50 328 8.0E-14
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 50 328 8.0E-14
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 50 328 8.0E-14
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 50 328 8.0E-14
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 67 328 7.0E-13
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 67 328 7.0E-13
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 67 328 7.0E-13
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 63 328 2.0E-12
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 67 320 8.0E-12
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 66 335 2.0E-11
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 67 328 3.0E-11
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 67 328 3.0E-11
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 67 328 3.0E-11
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 34 333 6.0E-11
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 67 320 1.0E-10
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 67 329 3.0E-10
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 65 259 1.0E-09
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 119 222 3.0E-09
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 108 229 2.0E-08
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 118 227 3.0E-08
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 52 227 4.0E-08
sp|Q6G5K3|UBIG_BARHE Ubiquinone biosynthesis O-methyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiG PE=3 SV=1 108 230 6.0E-08
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 118 227 8.0E-08
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 118 241 1.0E-07
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 121 227 2.0E-07
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 114 264 2.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 118 227 3.0E-07
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 116 235 4.0E-07
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 112 222 5.0E-07
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 104 226 6.0E-07
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 114 264 8.0E-07
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 124 225 1.0E-06
sp|A0PQ29|PHMT2_MYCUA Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2009 PE=3 SV=1 124 222 2.0E-06
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 118 222 2.0E-06
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 118 222 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2900
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7578 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3737
Ophiocordyceps camponoti-floridani Ophcf2|04730
Ophiocordyceps camponoti-rufipedis Ophun1|444
Ophiocordyceps kimflemingae Ophio5|7729
Ophiocordyceps subramaniannii Hirsu2|4837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7578
MNYDWILDGGYLPHAVIRIGIRRQLRERLASIEQSSLGEAVRAKMDFIDKLRRLPIAVETDSANAQHYEVGTGVL
QACLGPRMKYSSCLYGEPESWSTVWNMTLAQAEDAMLRLYVDRAGLKDGMTILDLGCGWGSGALFFAETLPRARI
VAFSNSRTQKEYIDGEARRRGLSNITVITGNVVDYEFEAESFDRVVSIELFEHMKNYELLMAKVSRALKPSGKLF
VHIFSHKTTPYNYEEGWMTTHFFTGGTMPSTDLLHYFQRHLTLQRQWWVNGMHYSRTCEDWLSNMATNKQQMWPH
LVETYGSDQAAKWYNRWQIFYMACSELFAYEKGDTWGVAHYLFEKPDGR*
Coding >OphauG2|7578
ATGAACTACGACTGGATATTGGATGGAGGCTACCTGCCGCATGCCGTGATCCGCATCGGGATCCGGCGACAGCTG
CGGGAGCGCCTGGCATCCATTGAGCAGTCGTCGCTGGGCGAGGCCGTCAGGGCCAAGATGGACTTTATCGACAAG
CTTCGGCGGCTGCCCATTGCCGTGGAGACTGATTCGGCCAATGCGCAGCACTACGAGGTGGGCACCGGCGTGCTG
CAGGCGTGTCTGGGCCCGCGGATGAAGTACTCGAGCTGTTTGTACGGCGAGCCAGAGTCGTGGTCGACAGTGTGG
AACATGACTTTGGCACAGGCAGAGGACGCCATGCTGCGCCTCTATGTAGACCGCGCTGGGCTCAAGGACGGCATG
ACTATTCTCGACTTGGGCTGTGGTTGGGGCTCGGGAGCCCTCTTCTTCGCTGAGACATTGCCTCGGGCTCGCATC
GTTGCCTTTTCCAACTCGCGCACACAAAAAGAGTACATTGACGGGGAGGCGCGCCGGCGCGGCTTATCCAACATA
ACCGTCATCACAGGCAATGTCGTCGACTACGAGTTTGAAGCCGAGTCGTTTGACCGCGTCGTGTCCATTGAGCTG
TTTGAGCACATGAAGAACTATGAGCTGCTCATGGCAAAAGTGTCGCGCGCGCTCAAACCCAGCGGCAAGTTATTT
GTGCACATATTTTCTCACAAGACAACACCCTACAACTACGAAGAGGGCTGGATGACGACGCACTTCTTCACGGGT
GGTACCATGCCGTCGACAGACCTGCTGCACTACTTTCAGCGCCACTTGACCTTGCAGAGGCAATGGTGGGTCAAT
GGCATGCACTACTCGCGAACGTGTGAGGACTGGCTGTCAAACATGGCGACCAATAAGCAGCAGATGTGGCCGCAC
TTGGTCGAGACATATGGCTCAGACCAGGCGGCAAAGTGGTACAACCGGTGGCAGATATTTTACATGGCATGCTCG
GAGCTGTTTGCATACGAAAAGGGCGACACGTGGGGCGTAGCGCACTATCTTTTTGAGAAGCCAGACGGGCGCTGA
Transcript >OphauG2|7578
ATGAACTACGACTGGATATTGGATGGAGGCTACCTGCCGCATGCCGTGATCCGCATCGGGATCCGGCGACAGCTG
CGGGAGCGCCTGGCATCCATTGAGCAGTCGTCGCTGGGCGAGGCCGTCAGGGCCAAGATGGACTTTATCGACAAG
CTTCGGCGGCTGCCCATTGCCGTGGAGACTGATTCGGCCAATGCGCAGCACTACGAGGTGGGCACCGGCGTGCTG
CAGGCGTGTCTGGGCCCGCGGATGAAGTACTCGAGCTGTTTGTACGGCGAGCCAGAGTCGTGGTCGACAGTGTGG
AACATGACTTTGGCACAGGCAGAGGACGCCATGCTGCGCCTCTATGTAGACCGCGCTGGGCTCAAGGACGGCATG
ACTATTCTCGACTTGGGCTGTGGTTGGGGCTCGGGAGCCCTCTTCTTCGCTGAGACATTGCCTCGGGCTCGCATC
GTTGCCTTTTCCAACTCGCGCACACAAAAAGAGTACATTGACGGGGAGGCGCGCCGGCGCGGCTTATCCAACATA
ACCGTCATCACAGGCAATGTCGTCGACTACGAGTTTGAAGCCGAGTCGTTTGACCGCGTCGTGTCCATTGAGCTG
TTTGAGCACATGAAGAACTATGAGCTGCTCATGGCAAAAGTGTCGCGCGCGCTCAAACCCAGCGGCAAGTTATTT
GTGCACATATTTTCTCACAAGACAACACCCTACAACTACGAAGAGGGCTGGATGACGACGCACTTCTTCACGGGT
GGTACCATGCCGTCGACAGACCTGCTGCACTACTTTCAGCGCCACTTGACCTTGCAGAGGCAATGGTGGGTCAAT
GGCATGCACTACTCGCGAACGTGTGAGGACTGGCTGTCAAACATGGCGACCAATAAGCAGCAGATGTGGCCGCAC
TTGGTCGAGACATATGGCTCAGACCAGGCGGCAAAGTGGTACAACCGGTGGCAGATATTTTACATGGCATGCTCG
GAGCTGTTTGCATACGAAAAGGGCGACACGTGGGGCGTAGCGCACTATCTTTTTGAGAAGCCAGACGGGCGCTGA
Gene >OphauG2|7578
ATGAACTACGGTGCGTCAAGATTCGCGCGCGGGACTGCTACTGCGAAGTCGACCTCGGACCACGTCAAAGCGGCC
AGGCTAATCAAGAAAAAACCATCGGCTTCAAGACTGGATATTGGATGGAGGCTACCTGCCGCATGCCGTGATCCG
CATCGGGATCCGGCGACAGCTGCGGGAGCGCCTGGCATCCATTGAGCAGTCGTCGCTGGGCGAGGCCGTCAGGGC
CAAGATGGACTTTATCGACAAGCTTCGGCGGCTGCCCATTGCCGTGGAGACTGATTCGGCCAATGCGCAGCACTA
CGAGGTGGGCACCGGCGTGCTGCAGGCGTGTCTGGGCCCGCGGATGAAGTACTCGAGCTGTTTGTACGGCGAGCC
AGAGTCGTGGTCGACAGTGTGGAACATGACTTTGGCACAGGCAGAGGACGCCATGCTGCGCCTCTATGTAGACCG
CGCTGGGCTCAAGGACGGCATGACTATTCTCGACTTGGGGTCAGTATATCCGTCTAGTGTTCCTTGCTGGAATTT
TGCGGCGCGGGCCCAGAGGGTCTAATCATGGCCTTTTGTAGCTGTGGTTGGGGCTCGGGAGCCCTCTTCTTCGCT
GAGACATTGCCTCGGGCTCGCATCGTTGCCTTTTCCAACTCGCGCACACAAAAAGAGTACATTGACGGGGAGGCG
CGCCGGCGCGGCTTATCCAACATAACCGTCATCACAGGCAATGTCGTCGACTACGAGTTTGAAGCCGAGTCGTTT
GACCGCGTCGTGTCCATTGAGGCAGGTTTCTCCCGATGCGCATATTATTGCGTCCTTGTGTCTCGTGACATGATG
GGTAGCTAATCAACCAAGTCGTTGGGATAGCTGTTTGAGCACATGAAGAACTATGAGCTGCTCATGGCAAAAGTG
TCGCGCGCGCTCAAACCCAGCGGCAAGTTATTTGTGCACATATTTTCTCACAAGACAACACCCTACAACTACGAA
GAGGGCTGGATGACGACGCACTTCTTCACGGGTGGTACCATGCCGTCGACAGACCTGCTGCACTACTTTCAGCGC
CACTTGACCTTGCAGAGGCAATGGTGGGTCAATGGCATGCACTACTCGCGAACGTGTGAGGTGAGTTGTGAATCA
CAATTGTCAATTTTAAGCCGTGCTTGTGCCGTCTTGTAGCTGAAGCTGCCATGTCAGGACTGGCTGTCAAACATG
GCGACCAATAAGCAGCAGATGTGGCCGCACTTGGTCGAGACATATGGCTCAGACCAGGCGGCAAAGTGGTACAAC
CGGTGGCAGATATTTTACATGGCATGCTCGGAGCTGTTTGCATACGAAAAGGGCGACACGTGGGGCGTAGCGCAC
TATCTTTTTGAGAAGCCAGACGGGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail