Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7578
Gene name
LocationContig_9:38561..39941
Strand-
Gene length (bp)1380
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.1E-35 63 333
PF08241 Methyltransf_11 Methyltransferase domain 9.8E-16 128 226
PF13649 Methyltransf_25 Methyltransferase domain 1.5E-14 127 222
PF13847 Methyltransf_31 Methyltransferase domain 2.5E-13 122 230
PF13489 Methyltransf_23 Methyltransferase domain 7.0E-10 117 254
PF08242 Methyltransf_12 Methyltransferase domain 9.6E-09 128 224
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.4E-07 116 236
PF05175 MTS Methyltransferase small domain 7.1E-07 124 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 12 345 6.0E-70
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 7 346 2.0E-69
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 7 345 5.0E-52
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 45 346 4.0E-51
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 10 346 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 12 345 6.0E-70
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 7 346 2.0E-69
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 7 345 5.0E-52
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 45 346 4.0E-51
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 10 346 2.0E-49
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 10 346 2.0E-49
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 21 346 2.0E-47
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 66 339 4.0E-25
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 66 339 4.0E-25
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 54 328 2.0E-18
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 54 328 2.0E-18
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 63 328 3.0E-18
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 63 328 3.0E-18
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 54 328 4.0E-18
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 68 328 1.0E-17
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 67 328 6.0E-17
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 67 328 8.0E-17
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 67 328 8.0E-17
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 67 340 6.0E-16
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 66 349 2.0E-15
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 67 340 2.0E-15
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 67 340 2.0E-15
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 50 328 8.0E-14
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 50 328 8.0E-14
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 50 328 8.0E-14
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 50 328 8.0E-14
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 67 328 7.0E-13
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 67 328 7.0E-13
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 67 328 7.0E-13
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 63 328 2.0E-12
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 67 320 8.0E-12
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 66 335 2.0E-11
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 67 328 3.0E-11
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 67 328 3.0E-11
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 67 328 3.0E-11
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 34 333 6.0E-11
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 67 320 1.0E-10
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 67 329 3.0E-10
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 65 259 1.0E-09
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 119 222 3.0E-09
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 108 229 2.0E-08
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 118 227 3.0E-08
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 52 227 4.0E-08
sp|Q6G5K3|UBIG_BARHE Ubiquinone biosynthesis O-methyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiG PE=3 SV=1 108 230 6.0E-08
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 118 227 8.0E-08
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 118 241 1.0E-07
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 121 227 2.0E-07
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 114 264 2.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 118 227 3.0E-07
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 116 235 4.0E-07
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 112 222 5.0E-07
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 104 226 6.0E-07
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 114 264 8.0E-07
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 124 225 1.0E-06
sp|A0PQ29|PHMT2_MYCUA Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2009 PE=3 SV=1 124 222 2.0E-06
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 118 222 2.0E-06
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 118 222 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7578
MNYDWILDGGYLPHAVIRIGIRRQLRERLASIEQSSLGEAVRAKMDFIDKLRRLPIAVETDSANAQHYEVGTGVL
QACLGPRMKYSSCLYGEPESWSTVWNMTLAQAEDAMLRLYVDRAGLKDGMTILDLGCGWGSGALFFAETLPRARI
VAFSNSRTQKEYIDGEARRRGLSNITVITGNVVDYEFEAESFDRVVSIELFEHMKNYELLMAKVSRALKPSGKLF
VHIFSHKTTPYNYEEGWMTTHFFTGGTMPSTDLLHYFQRHLTLQRQWWVNGMHYSRTCEDWLSNMATNKQQMWPH
LVETYGSDQAAKWYNRWQIFYMACSELFAYEKGDTWGVAHYLFEKPDGR*
Coding >OphauG2|7578
ATGAACTACGACTGGATATTGGATGGAGGCTACCTGCCGCATGCCGTGATCCGCATCGGGATCCGGCGACAGCTG
CGGGAGCGCCTGGCATCCATTGAGCAGTCGTCGCTGGGCGAGGCCGTCAGGGCCAAGATGGACTTTATCGACAAG
CTTCGGCGGCTGCCCATTGCCGTGGAGACTGATTCGGCCAATGCGCAGCACTACGAGGTGGGCACCGGCGTGCTG
CAGGCGTGTCTGGGCCCGCGGATGAAGTACTCGAGCTGTTTGTACGGCGAGCCAGAGTCGTGGTCGACAGTGTGG
AACATGACTTTGGCACAGGCAGAGGACGCCATGCTGCGCCTCTATGTAGACCGCGCTGGGCTCAAGGACGGCATG
ACTATTCTCGACTTGGGCTGTGGTTGGGGCTCGGGAGCCCTCTTCTTCGCTGAGACATTGCCTCGGGCTCGCATC
GTTGCCTTTTCCAACTCGCGCACACAAAAAGAGTACATTGACGGGGAGGCGCGCCGGCGCGGCTTATCCAACATA
ACCGTCATCACAGGCAATGTCGTCGACTACGAGTTTGAAGCCGAGTCGTTTGACCGCGTCGTGTCCATTGAGCTG
TTTGAGCACATGAAGAACTATGAGCTGCTCATGGCAAAAGTGTCGCGCGCGCTCAAACCCAGCGGCAAGTTATTT
GTGCACATATTTTCTCACAAGACAACACCCTACAACTACGAAGAGGGCTGGATGACGACGCACTTCTTCACGGGT
GGTACCATGCCGTCGACAGACCTGCTGCACTACTTTCAGCGCCACTTGACCTTGCAGAGGCAATGGTGGGTCAAT
GGCATGCACTACTCGCGAACGTGTGAGGACTGGCTGTCAAACATGGCGACCAATAAGCAGCAGATGTGGCCGCAC
TTGGTCGAGACATATGGCTCAGACCAGGCGGCAAAGTGGTACAACCGGTGGCAGATATTTTACATGGCATGCTCG
GAGCTGTTTGCATACGAAAAGGGCGACACGTGGGGCGTAGCGCACTATCTTTTTGAGAAGCCAGACGGGCGCTGA
Transcript >OphauG2|7578
ATGAACTACGACTGGATATTGGATGGAGGCTACCTGCCGCATGCCGTGATCCGCATCGGGATCCGGCGACAGCTG
CGGGAGCGCCTGGCATCCATTGAGCAGTCGTCGCTGGGCGAGGCCGTCAGGGCCAAGATGGACTTTATCGACAAG
CTTCGGCGGCTGCCCATTGCCGTGGAGACTGATTCGGCCAATGCGCAGCACTACGAGGTGGGCACCGGCGTGCTG
CAGGCGTGTCTGGGCCCGCGGATGAAGTACTCGAGCTGTTTGTACGGCGAGCCAGAGTCGTGGTCGACAGTGTGG
AACATGACTTTGGCACAGGCAGAGGACGCCATGCTGCGCCTCTATGTAGACCGCGCTGGGCTCAAGGACGGCATG
ACTATTCTCGACTTGGGCTGTGGTTGGGGCTCGGGAGCCCTCTTCTTCGCTGAGACATTGCCTCGGGCTCGCATC
GTTGCCTTTTCCAACTCGCGCACACAAAAAGAGTACATTGACGGGGAGGCGCGCCGGCGCGGCTTATCCAACATA
ACCGTCATCACAGGCAATGTCGTCGACTACGAGTTTGAAGCCGAGTCGTTTGACCGCGTCGTGTCCATTGAGCTG
TTTGAGCACATGAAGAACTATGAGCTGCTCATGGCAAAAGTGTCGCGCGCGCTCAAACCCAGCGGCAAGTTATTT
GTGCACATATTTTCTCACAAGACAACACCCTACAACTACGAAGAGGGCTGGATGACGACGCACTTCTTCACGGGT
GGTACCATGCCGTCGACAGACCTGCTGCACTACTTTCAGCGCCACTTGACCTTGCAGAGGCAATGGTGGGTCAAT
GGCATGCACTACTCGCGAACGTGTGAGGACTGGCTGTCAAACATGGCGACCAATAAGCAGCAGATGTGGCCGCAC
TTGGTCGAGACATATGGCTCAGACCAGGCGGCAAAGTGGTACAACCGGTGGCAGATATTTTACATGGCATGCTCG
GAGCTGTTTGCATACGAAAAGGGCGACACGTGGGGCGTAGCGCACTATCTTTTTGAGAAGCCAGACGGGCGCTGA
Gene >OphauG2|7578
ATGAACTACGGTGCGTCAAGATTCGCGCGCGGGACTGCTACTGCGAAGTCGACCTCGGACCACGTCAAAGCGGCC
AGGCTAATCAAGAAAAAACCATCGGCTTCAAGACTGGATATTGGATGGAGGCTACCTGCCGCATGCCGTGATCCG
CATCGGGATCCGGCGACAGCTGCGGGAGCGCCTGGCATCCATTGAGCAGTCGTCGCTGGGCGAGGCCGTCAGGGC
CAAGATGGACTTTATCGACAAGCTTCGGCGGCTGCCCATTGCCGTGGAGACTGATTCGGCCAATGCGCAGCACTA
CGAGGTGGGCACCGGCGTGCTGCAGGCGTGTCTGGGCCCGCGGATGAAGTACTCGAGCTGTTTGTACGGCGAGCC
AGAGTCGTGGTCGACAGTGTGGAACATGACTTTGGCACAGGCAGAGGACGCCATGCTGCGCCTCTATGTAGACCG
CGCTGGGCTCAAGGACGGCATGACTATTCTCGACTTGGGGTCAGTATATCCGTCTAGTGTTCCTTGCTGGAATTT
TGCGGCGCGGGCCCAGAGGGTCTAATCATGGCCTTTTGTAGCTGTGGTTGGGGCTCGGGAGCCCTCTTCTTCGCT
GAGACATTGCCTCGGGCTCGCATCGTTGCCTTTTCCAACTCGCGCACACAAAAAGAGTACATTGACGGGGAGGCG
CGCCGGCGCGGCTTATCCAACATAACCGTCATCACAGGCAATGTCGTCGACTACGAGTTTGAAGCCGAGTCGTTT
GACCGCGTCGTGTCCATTGAGGCAGGTTTCTCCCGATGCGCATATTATTGCGTCCTTGTGTCTCGTGACATGATG
GGTAGCTAATCAACCAAGTCGTTGGGATAGCTGTTTGAGCACATGAAGAACTATGAGCTGCTCATGGCAAAAGTG
TCGCGCGCGCTCAAACCCAGCGGCAAGTTATTTGTGCACATATTTTCTCACAAGACAACACCCTACAACTACGAA
GAGGGCTGGATGACGACGCACTTCTTCACGGGTGGTACCATGCCGTCGACAGACCTGCTGCACTACTTTCAGCGC
CACTTGACCTTGCAGAGGCAATGGTGGGTCAATGGCATGCACTACTCGCGAACGTGTGAGGTGAGTTGTGAATCA
CAATTGTCAATTTTAAGCCGTGCTTGTGCCGTCTTGTAGCTGAAGCTGCCATGTCAGGACTGGCTGTCAAACATG
GCGACCAATAAGCAGCAGATGTGGCCGCACTTGGTCGAGACATATGGCTCAGACCAGGCGGCAAAGTGGTACAAC
CGGTGGCAGATATTTTACATGGCATGCTCGGAGCTGTTTGCATACGAAAAGGGCGACACGTGGGGCGTAGCGCAC
TATCTTTTTGAGAAGCCAGACGGGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail